StarFunc result for job id O95484

User Input

>input (217 residues)
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
AGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL
LCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95484	1.000	1.000	8.019E-33	217	1.000	1.000	O95484.pdb.gz	CLD9_HUMAN Claudin-9 OS=Homo sapiens OX=9606 GN=CLDN9 PE=1 SV=1
2	AFDB:P56747	0.920	0.908	4.449E-26	220	0.728	0.718	P56747.pdb.gz	CLD6_HUMAN Claudin-6 OS=Homo sapiens OX=9606 GN=CLDN6 PE=1 SV=2
3	AFDB:Q9Z262	0.870	0.862	1.010E-25	219	0.710	0.703	Q9Z262.pdb.gz	CLD6_MOUSE Claudin-6 OS=Mus musculus OX=10090 GN=Cldn6 PE=1 SV=1
4	AFDB:Q90XR2	0.886	0.882	6.729E-25	218	0.622	0.619	Q90XR2.pdb.gz	Q90XR2_DANRE Claudin-3 OS=Danio rerio OX=7955 GN=cldnc PE=2 SV=1
5	AFDB:Q98SR2	0.876	0.888	1.067E-24	214	0.664	0.673	Q98SR2.pdb.gz	Q98SR2_CHICK Claudin OS=Gallus gallus OX=9031 GN=cldn3 PE=1 SV=1
6	AFDB:Q90XR8	0.891	0.898	1.693E-24	215	0.581	0.586	Q90XR8.pdb.gz	Q90XR8_DANRE Claudin b OS=Danio rerio OX=7955 GN=wu:fa66b05 PE=2 SV=1
7	AFDB:O14493	0.891	0.924	3.652E-24	209	0.613	0.636	O14493.pdb.gz	CLD4_HUMAN Claudin-4 OS=Homo sapiens OX=9606 GN=CLDN4 PE=1 SV=1
8	AFDB:O35054	0.857	0.885	4.966E-24	210	0.585	0.605	O35054.pdb.gz	CLD4_MOUSE Claudin-4 OS=Mus musculus OX=10090 GN=Cldn4 PE=1 SV=1
9	AFDB:O15551	0.845	0.834	1.534E-23	220	0.645	0.636	O15551.pdb.gz	CLD3_HUMAN Claudin-3 OS=Homo sapiens OX=9606 GN=CLDN3 PE=1 SV=1
10	AFDB:Q90XR9	0.874	0.907	4.985E-23	209	0.562	0.584	Q90XR9.pdb.gz	Q90XR9_DANRE Claudin OS=Danio rerio OX=7955 GN=cb84 PE=1 SV=1
11	PDB:6ov2A	0.801	0.950	1.313E-22	182	0.834	0.995	6ov2A.pdb.gz
12	PDB:5b2gC	0.788	0.497	1.482E-17	350	0.576	0.357	5b2gC.pdb.gz
13	PDB:5kbtA	0.649	0.156	8.815E-6	973	0.161	0.036	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
14	PDB:7rzaA	0.653	0.161	2.107E-5	981	0.152	0.034	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
15	PDB:7ocaI	0.592	0.684	3.702E-5	185	0.180	0.211	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
16	PDB:7rz4A	0.537	0.145	4.783E-5	993	0.124	0.027	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
17	PDB:6jp5E	0.603	0.754	5.300E-5	169	0.147	0.189	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
18	PDB:6wxuB	0.467	0.383	1.403E-4	273	0.120	0.095	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
19	PDB:5weoA	0.578	0.142	1.723E-4	988	0.161	0.035	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
20	PDB:7d3eB	0.458	0.377	4.801E-4	272	0.129	0.103	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95484	1.36e-152	424	217	1.000	1.000	CLD9_HUMAN Claudin-9 OS=Homo sapiens OX=9606 GN=CLDN9 PE=1 SV=1
2	Q9Z0S7	1.32e-149	416	217	0.972	0.972	CLD9_MOUSE Claudin-9 OS=Mus musculus OX=10090 GN=Cldn9 PE=2 SV=2
3	P56747	1.55e-102	297	220	0.728	0.718	CLD6_HUMAN Claudin-6 OS=Homo sapiens OX=9606 GN=CLDN6 PE=1 SV=2
4	Q90XR2	4.94e-99	288	218	0.622	0.619	Q90XR2_DANRE Claudin-3 OS=Danio rerio OX=7955 GN=cldnc PE=2 SV=1
5	Q98SR2	9.23e-98	285	214	0.664	0.673	Q98SR2_CHICK Claudin OS=Gallus gallus OX=9031 GN=cldn3 PE=1 SV=1
6	Q90XR8	6.72e-95	278	215	0.581	0.586	Q90XR8_DANRE Claudin b OS=Danio rerio OX=7955 GN=wu:fa66b05 PE=2 SV=1
7	Q9Z262	7.06e-93	273	219	0.710	0.703	CLD6_MOUSE Claudin-6 OS=Mus musculus OX=10090 GN=Cldn6 PE=1 SV=1
8	Q5XIT8	3.55e-91	268	210	0.594	0.614	Q5XIT8_RAT Claudin OS=Rattus norvegicus OX=10116 GN=Cldn4 PE=2 SV=1
9	O35054	9.51e-91	267	210	0.585	0.605	CLD4_MOUSE Claudin-4 OS=Mus musculus OX=10090 GN=Cldn4 PE=1 SV=1
10	B1H3P7	1.25e-90	266	208	0.558	0.582	B1H3P7_SALSA Claudin 30 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
11	B9EL29	1.57e-90	266	208	0.558	0.582	B9EL29_SALSA Claudin-4 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
12	O14493	6.89e-90	265	209	0.594	0.617	CLD4_HUMAN Claudin-4 OS=Homo sapiens OX=9606 GN=CLDN4 PE=1 SV=1
13	Q90XR9	8.95e-90	264	209	0.576	0.598	Q90XR9_DANRE Claudin OS=Danio rerio OX=7955 GN=cb84 PE=1 SV=1
14	Q63400	2.17e-89	264	219	0.641	0.635	CLD3_RAT Claudin-3 OS=Rattus norvegicus OX=10116 GN=Cldn3 PE=1 SV=2
15	B9ENQ3	8.52e-89	262	208	0.548	0.572	B9ENQ3_SALSA Claudin-4 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
16	B5XFB8	1.24e-88	261	208	0.548	0.572	B5XFB8_SALSA Claudin-4 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
17	O15551	1.32e-87	259	220	0.645	0.636	CLD3_HUMAN Claudin-3 OS=Homo sapiens OX=9606 GN=CLDN3 PE=1 SV=1
18	B9EP74	2.75e-87	258	201	0.539	0.582	B9EP74_SALSA Claudin-4 OS=Salmo salar OX=8030 GN=CLD4 PE=2 SV=1
19	Q6NUZ6	4.23e-86	255	215	0.585	0.591	Q6NUZ6_DANRE Claudin OS=Danio rerio OX=7955 GN=zgc:85723 PE=1 SV=1
20	Q9Z0G9	7.59e-85	252	219	0.645	0.639	CLD3_MOUSE Claudin-3 OS=Mus musculus OX=10090 GN=Cldn3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	3.3e-06	38.5	PMP-22/EMP/MP20/Claudin tight junction
2	PF00822 PMP22_Claudin	2.9e-29	113.6	PMP-22/EMP/MP20/Claudin family
3	PF05915 TMEM_230_134	22	16.6	Transmembrane proteins 230/134

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010374389.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010382022.1	0.843	Belongs to the MAGUK family.
2	61622.XP_010378538.1	0.833	May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier.
3	61622.XP_010365579.1	0.799	Belongs to the MAGUK family.
4	61622.XP_010384149.1	0.715	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
5	61622.XP_010351165.1	0.711	Claudin 34
6	61622.XP_010355963.1	0.708	Anterior gradient 2, protein disulphide isomerase family member
7	61622.XP_010384148.1	0.699	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
8	61622.XP_010362596.1	0.683	Epithelial cell adhesion molecule
9	61622.XP_010364042.1	0.683	Tumor-associated calcium signal transducer 2
10	61622.XP_010366114.1	0.679	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
11	61622.XP_010375627.1	0.658	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
12	61622.XP_010351744.1	0.656	Claudin-23
13	61622.XP_010357210.1	0.652	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
14	61622.XP_010385769.1	0.651	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
15	61622.XP_010354671.1	0.650	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
16	61622.XP_010371853.1	0.647	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
17	61622.XP_010383276.1	0.645	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
18	61622.XP_010376213.1	0.643	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
19	61622.XP_010385703.1	0.642	Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity
20	61622.XP_010374388.1	0.641	Claudin 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140272	0.810	exogenous protein binding
GO:0001618	0.795	virus receptor activity
GO:0042802	0.354	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.998	cellular component organization
GO:0034330	0.989	cell junction organization
GO:0045216	0.981	cell-cell junction organization
GO:0120193	0.968	tight junction organization
GO:0065007	0.854	biological regulation
GO:0050794	0.828	regulation of cellular process
GO:0048518	0.627	positive regulation of biological process
GO:0044085	0.584	cellular component biogenesis
GO:0032502	0.565	developmental process
GO:0048856	0.554	anatomical structure development
GO:0022607	0.538	cellular component assembly
GO:0048522	0.534	positive regulation of cellular process
GO:0034329	0.477	cell junction assembly
GO:0007043	0.470	cell-cell junction assembly
GO:0050896	0.421	response to stimulus
GO:0019222	0.383	regulation of metabolic process
GO:0032501	0.372	multicellular organismal process
GO:0060255	0.368	regulation of macromolecule metabolic process
GO:0048519	0.327	negative regulation of biological process
GO:0040012	0.320	regulation of locomotion
GO:0010604	0.308	positive regulation of macromolecule metabolic process
GO:2000145	0.307	regulation of cell motility
GO:0048523	0.302	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005886	1.000	plasma membrane
GO:0043296	0.968	apical junction complex
GO:0070160	0.959	tight junction
GO:0043226	0.885	organelle
GO:0005923	0.868	bicellular tight junction
GO:0005622	0.778	intracellular anatomical structure
GO:0043227	0.635	membrane-bounded organelle
GO:0043229	0.616	intracellular organelle
GO:0043231	0.549	intracellular membrane-bounded organelle
GO:0005737	0.327	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]