StarFunc result for job id O95486

User Input

>input (1093 residues)
MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESVSQGYNFQLPGSYPH
PIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTP
MPSSSFLPEANLPPPLNWQYNYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPS
LQNSFIKSGPSVPPLVNPPLPTTFQPGAPHGPPPAGGPPPVRALTPLTSSYRDVPQPLFN
SAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQ
NTTPPGATGVPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRVVNLLQERNML
PSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQL
PVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRR
PEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNT
RTKIGFITFDSTIHFYGLQESLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLK
TLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNHRSS
AKDIHMTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYH
HQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVN
PDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADV
QAISGLLANMAVDRSMTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVPFSLRLFP
LFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNI
SDRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQP
MTDLPELDTPESARIIAFISWLREQRPFFPILYVIRDESPMKANFLQNMIEDRTESALSY
YEFLLHIQQQVNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZW15	0.706	0.623	0.000	1242	0.597	0.526	D3ZW15.pdb.gz	D3ZW15_RAT SEC24 homolog B, COPII coat complex component OS=Rattus norvegicus OX=10116 GN=Sec24b PE=3 SV=2
2	AFDB:O95486	1.000	1.000	0.000	1093	1.000	1.000	O95486.pdb.gz	SC24A_HUMAN Protein transport protein Sec24A OS=Homo sapiens OX=9606 GN=SEC24A PE=1 SV=2
3	AFDB:O95487	0.717	0.620	0.000	1268	0.602	0.519	O95487.pdb.gz	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
4	AFDB:Q3U2P1	0.788	0.790	0.000	1090	0.884	0.886	Q3U2P1.pdb.gz	SC24A_MOUSE Protein transport protein Sec24A OS=Mus musculus OX=10090 GN=Sec24a PE=1 SV=1
5	AFDB:Q9VQ94	0.622	0.572	3.360E-69	1193	0.289	0.265	Q9VQ94.pdb.gz	Q9VQ94_DROME LP05220p OS=Drosophila melanogaster OX=7227 GN=Sec24CD PE=1 SV=2
6	AFDB:G3X972	0.625	0.623	1.755E-68	1096	0.267	0.266	G3X972.pdb.gz	G3X972_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
7	PDB:6zgaB	0.643	0.887	3.328E-62	786	0.231	0.321	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
8	PDB:1m2vA	0.509	0.768	4.676E-39	705	0.133	0.206	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
9	PDB:5kynA	0.511	0.745	4.455E-38	730	0.127	0.190	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
10	PDB:6zgaA	0.511	0.724	1.358E-30	751	0.134	0.196	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
11	PDB:6ujaB	0.137	0.328	1.280E-6	359	0.046	0.139	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
12	PDB:7nxdB	0.142	0.205	3.316E-6	690	0.039	0.062	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
13	PDB:4g1eB	0.132	0.185	8.588E-6	709	0.033	0.051	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
14	PDB:1u8cB	0.131	0.209	3.159E-5	599	0.038	0.070	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
15	PDB:5es4B	0.138	0.205	3.492E-5	674	0.044	0.071	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
16	PDB:6jp8F	0.129	0.143	3.860E-5	973	0.033	0.037	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
17	AFDB:Q2UY09	0.126	0.123	2.651E-3	1125	0.091	0.089	Q2UY09.pdb.gz	COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens OX=9606 GN=COL28A1 PE=2 SV=2
18	AFDB:E7FCV8	0.138	0.147	1.317E-2	1015	0.093	0.100	E7FCV8.pdb.gz	E7FCV8_DANRE Collagen alpha-2(VI) chain isoform X4 OS=Danio rerio OX=7955 GN=col6a2 PE=1 SV=3
19	AFDB:L0N7N1	0.072	0.056	2.177E-1	1674	0.121	0.079	L0N7N1.pdb.gz	KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus OX=10090 GN=Kif14 PE=1 SV=1
20	AFDB:A0A0B4LFV4	0.073	0.097	8.008E-1	742	0.090	0.132	A0A0B4LFV4.pdb.gz	A0A0B4LFV4_DROME Rad, Gem/Kir family member 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Rgk2 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZW15	0.0	1171	1252	0.521	0.454	D3ZW15_RAT SEC24 homolog B, COPII coat complex component OS=Rattus norvegicus OX=10116 GN=Sec24b PE=3 SV=2
2	F6VJC5	0.0	902	765	0.401	0.573	F6VJC5_MOUSE Sec24 related gene family, member B (S. cerevisiae) (Fragment) OS=Mus musculus OX=10090 GN=Sec24b PE=1 SV=1
3	O95486	0.0	2224	1093	1.000	1.000	SC24A_HUMAN Protein transport protein Sec24A OS=Homo sapiens OX=9606 GN=SEC24A PE=1 SV=2
4	O95487	0.0	1255	1268	0.543	0.468	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
5	Q3U2P1	0.0	1895	1090	0.886	0.888	SC24A_MOUSE Protein transport protein Sec24A OS=Mus musculus OX=10090 GN=Sec24a PE=1 SV=1
6	Q3U882	0.0	902	716	0.401	0.612	Q3U882_MOUSE Protein transport protein Sec24B (Fragment) OS=Mus musculus OX=10090 GN=Sec24b PE=2 SV=1
7	Q3UDH4	0.0	1177	1023	0.522	0.558	Q3UDH4_MOUSE Sec24b protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24b PE=2 SV=1
8	Q6PFZ1	0.0	579	838	0.260	0.339	Q6PFZ1_MOUSE Sec24b protein OS=Mus musculus OX=10090 GN=Sec24b PE=2 SV=1
9	Q80ZX0	0.0	1181	1251	0.524	0.458	Q80ZX0_MOUSE Sec24 related gene family, member B (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24b PE=1 SV=1
10	Q9SFU0	0.0	562	1038	0.269	0.283	SC24A_ARATH Protein transport protein SEC24 A OS=Arabidopsis thaliana OX=3702 GN=SEC24A PE=1 SV=2
11	Q9UUI5	1.30e-151	478	926	0.245	0.289	SEC24_SCHPO Protein transport protein sec24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec24 PE=2 SV=1
12	C0H5J6	3.38e-134	432	940	0.237	0.276	C0H5J6_PLAF7 Protein transport protein Sec24A OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1361100 PE=4 SV=1
13	P40482	1.13e-133	430	926	0.225	0.266	SEC24_YEAST Protein transport protein SEC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC24 PE=1 SV=1
14	Q9M291	1.09e-128	421	1096	0.221	0.221	SC24B_ARATH Protein transport protein SEC24 B OS=Arabidopsis thaliana OX=3702 GN=SEC24B PE=2 SV=3
15	P53953	3.43e-126	409	876	0.231	0.288	SFB2_YEAST SED5-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFB2 PE=1 SV=1
16	P53992	5.97e-120	397	1094	0.206	0.206	SC24C_HUMAN Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3
17	F1QRB4	3.94e-117	389	1030	0.195	0.207	F1QRB4_DANRE Protein transport protein Sec24D isoform X1 OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=2
18	Q8CGF4	4.59e-117	390	1096	0.201	0.201	Q8CGF4_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
19	G3X972	4.78e-117	390	1096	0.201	0.201	G3X972_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
20	A0A286YDI8	7.50e-117	387	1020	0.201	0.216	A0A286YDI8_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00626 Gelsolin	1.6e-07	42.4	Gelsolin repeat
2	PF08033 Sec23_BS	2.7e-17	74.6	Sec23/Sec24 beta-sandwich domain
3	PF04815 Sec23_helical	1.9e-19	80.8	Sec23/Sec24 helical domain
4	PF04811 Sec23_trunk	4.9e-83	290.0	Sec23/Sec24 trunk domain
5	PF04810 zf-Sec23_Sec24	5.1e-11	53.8	Sec23/Sec24 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306881	0.999	Protein transport protein Sec23A
2	9606.ENSP00000373312	0.998	Protein SEC13 homolog
3	9606.ENSP00000280551	0.996	Protein transport protein Sec24D
4	9606.ENSP00000378721	0.996	Protein transport protein Sec31A
5	9606.ENSP00000343405	0.995	Protein transport protein Sec24C
6	9606.ENSP00000362339	0.995	GTP-binding protein SAR1a
7	9606.ENSP00000338844	0.991	Protein transport protein Sec23B
8	9606.ENSP00000463393	0.989	Vesicle-trafficking protein SEC22b
9	9606.ENSP00000385432	0.984	GTP-binding protein SAR1b
10	9606.ENSP00000325827	0.981	Protein transport protein Sec16A
11	9606.ENSP00000359370	0.975	Protein transport protein Sec31B
12	9606.ENSP00000428564	0.961	Protein transport protein Sec24B
13	9606.ENSP00000260643	0.946	Prolactin regulatory element-binding protein
14	9606.ENSP00000294179	0.931	Syntaxin-5
15	9606.ENSP00000362807	0.931	Peflin
16	9606.ENSP00000356230	0.928	Kelch-like protein 12
17	9606.ENSP00000405926	0.923	Transmembrane emp24 domain-containing protein 7
18	9606.ENSP00000264933	0.920	Programmed cell death protein 6
19	9606.ENSP00000382379	0.908	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
20	9606.ENSP00000251047	0.907	Protein ERGIC-53

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008270	0.999	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0051234	0.976	establishment of localization
GO:0006810	0.965	transport
GO:0006888	0.964	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006900	0.943	vesicle budding from membrane
GO:0065007	0.849	biological regulation
GO:0050789	0.721	regulation of biological process
GO:0050794	0.665	regulation of cellular process
GO:0048518	0.335	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005783	0.998	endoplasmic reticulum
GO:0012507	0.997	ER to Golgi transport vesicle membrane
GO:0098796	0.992	membrane protein complex
GO:0005829	0.992	cytosol
GO:0005789	0.979	endoplasmic reticulum membrane
GO:0030127	0.965	COPII vesicle coat
GO:0070013	0.339	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]