StarFunc result for job id O95487

User Input

>input (1268 residues)
MSAPAGSSHPAASARIPPKFGGAAVSGAAAPAGPGAGPAPHQQNGPAQNQMQVPSGYGLH
HQNYIAPSGHYSQGPGKMTSLPLDTQCGDYYSALYTVPTQNVTPNTVNQQPGAQQLYSRG
PPAPHIVGSTLGSFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTC
GHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVRPVKDNSFSGQNTAISHPSPL
PPLPSQQHHQQQSLSGYSTLTWSSPGLPSTQDNLIRNHTGSLAVANNNPTITVADSLSCP
VMQNVQPPKSSPVVSTVLSGSSGSSSTRTPPTANHPVEPVTSVTQPSELLQQKGVQYGEY
VNNQASSAPTPLSSTSDDEEEEEEDEEAGVDSSSTTSSASPMPNSYDALEGGSYPDMLSS
SASSPAPDPAPEPDPASAPAPASAPAPVVPQPSKMAKPFGYGYPTLQPGYQNATAPLISG
VQPSNPVYSGFQQYPQQYPGVNQLSSSIGGLSLQSSPQPESLRPVNLTQERNILPMTPVW
APVPNLNADLKKLNCSPDSFRCTLTNIPQTQALLNKAKLPLGLLLHPFRDLTQLPVITSN
TIVRCRSCRTYINPFVSFIDQRRWKCNLCYRVNDVPEEFMYNPLTRSYGEPHKRPEVQNS
TVEFIASSDYMLRPPQPAVYLFVLDVSHNAVEAGYLTILCQSLLENLDKLPGDSRTRIGF
MTFDSTIHFYNLQEGLSQPQMLIVSDIDDVFLPTPDSLLVNLYESKELIKDLLNALPNMF
TNTRETHSALGPALQAAFKLMSPTGGRVSVFQTQLPSLGAGLLQSREDPNQRSSTKVVQH
LGPATDFYKKLALDCSGQQTAVDLFLLSSQYSDLASLACMSKYSAGCIYYYPSFHYTHNP
SQAEKLQKDLKRYLTRKIGFEAVMRIRCTKGLSMHTFHGNFFVRSTDLLSLANINPDAGF
AVQLSIEESLTDTSLVCFQTALLYTSSKGERRIRVHTLCLPVVSSLADVYAGVDVQAAIC
LLANMAVDRSVSSSLSDARDALVNAVVDSLSAYGSTVSNLQHSALMAPSSLKLFPLYVLA
LLKQKAFRTGTSTRLDDRVYAMCQIKSQPLVHLMKMIHPNLYRIDRLTDEGAVHVNDRIV
PQPPLQKLSAEKLTREGAFLMDCGSVFYIWVGKGCDNNFIEDVLGYTNFASIPQKMTHLP
ELDTLSSERARSFITWLRDSRPLSPILHIVKDESPAKAEFFQHLIEDRTEAAFSYYEFLL
HVQQQICK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZW15	0.650	0.664	0.000	1242	0.829	0.846	D3ZW15.pdb.gz	D3ZW15_RAT SEC24 homolog B, COPII coat complex component OS=Rattus norvegicus OX=10116 GN=Sec24b PE=3 SV=2
2	AFDB:O95487	1.000	1.000	0.000	1268	1.000	1.000	O95487.pdb.gz	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
3	AFDB:Q9VQ94	0.538	0.571	1.514E-69	1193	0.254	0.270	Q9VQ94.pdb.gz	Q9VQ94_DROME LP05220p OS=Drosophila melanogaster OX=7227 GN=Sec24CD PE=1 SV=2
4	PDB:6zgaB	0.556	0.882	3.491E-64	786	0.206	0.332	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
5	PDB:1m2vA	0.446	0.775	4.195E-39	705	0.106	0.191	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
6	PDB:5kynA	0.455	0.767	4.624E-38	730	0.106	0.184	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
7	PDB:6zgaA	0.450	0.734	1.685E-30	751	0.109	0.184	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
8	PDB:6ujaB	0.119	0.326	1.353E-6	359	0.035	0.125	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
9	PDB:7nxdB	0.127	0.206	1.651E-5	690	0.032	0.059	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
10	PDB:4g1eB	0.119	0.191	1.738E-5	709	0.033	0.059	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
11	PDB:1u8cB	0.115	0.206	3.207E-5	599	0.034	0.072	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
12	PDB:2xwbF	0.112	0.182	1.092E-4	714	0.032	0.056	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
13	PDB:5es4B	0.131	0.219	1.410E-4	674	0.039	0.073	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
14	AFDB:Q57W20	0.072	0.068	2.322	1370	0.126	0.117	Q57W20.pdb.gz	Q57W20_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28I8.20 PE=4 SV=1
15	AFDB:A0A0B4LFV4	0.054	0.081	2.572	742	0.091	0.156	A0A0B4LFV4.pdb.gz	A0A0B4LFV4_DROME Rad, Gem/Kir family member 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Rgk2 PE=4 SV=1
16	AFDB:C9JF13	0.035	0.044	4.072	903	0.079	0.111	C9JF13.pdb.gz	C9JF13_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
17	AFDB:Q4WJ81	0.033	0.049	5.531	754	0.074	0.125	Q4WJ81.pdb.gz	CRZA_ASPFU C2H2 finger domain transcription factor crzA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=crzA PE=1 SV=1
18	AFDB:P53739	0.038	0.049	7.514	893	0.066	0.094	P53739.pdb.gz	FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPK1 PE=1 SV=1
19	AFDB:A0A2K1J5A5	0.032	0.047	8.758	709	0.056	0.100	A0A2K1J5A5.pdb.gz	SOK3_PHYPA Protein SOSEKI 3 OS=Physcomitrium patens OX=3218 GN=SOK3 PE=1 SV=1
20	AFDB:Q586E3	0.047	0.064	8.758	764	0.090	0.149	Q586E3.pdb.gz	Q586E3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.110 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZW15	0.0	1995	1252	0.836	0.847	D3ZW15_RAT SEC24 homolog B, COPII coat complex component OS=Rattus norvegicus OX=10116 GN=Sec24b PE=3 SV=2
2	F6VJC5	0.0	1227	765	0.519	0.860	F6VJC5_MOUSE Sec24 related gene family, member B (S. cerevisiae) (Fragment) OS=Mus musculus OX=10090 GN=Sec24b PE=1 SV=1
3	O95486	0.0	1257	1093	0.468	0.543	SC24A_HUMAN Protein transport protein Sec24A OS=Homo sapiens OX=9606 GN=SEC24A PE=1 SV=2
4	O95487	0.0	2601	1268	1.000	1.000	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
5	Q3U2P1	0.0	1248	1090	0.474	0.551	SC24A_MOUSE Protein transport protein Sec24A OS=Mus musculus OX=10090 GN=Sec24a PE=1 SV=1
6	Q3U882	0.0	1196	716	0.507	0.898	Q3U882_MOUSE Protein transport protein Sec24B (Fragment) OS=Mus musculus OX=10090 GN=Sec24b PE=2 SV=1
7	Q3UDH4	0.0	1667	1023	0.691	0.856	Q3UDH4_MOUSE Sec24b protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24b PE=2 SV=1
8	Q6PFZ1	0.0	1152	838	0.528	0.800	Q6PFZ1_MOUSE Sec24b protein OS=Mus musculus OX=10090 GN=Sec24b PE=2 SV=1
9	Q80ZX0	0.0	1937	1251	0.826	0.838	Q80ZX0_MOUSE Sec24 related gene family, member B (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24b PE=1 SV=1
10	Q9SFU0	6.71e-175	547	1038	0.234	0.286	SC24A_ARATH Protein transport protein SEC24 A OS=Arabidopsis thaliana OX=3702 GN=SEC24A PE=1 SV=2
11	Q9UUI5	2.40e-144	463	926	0.212	0.290	SEC24_SCHPO Protein transport protein sec24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec24 PE=2 SV=1
12	P40482	7.31e-132	429	926	0.205	0.281	SEC24_YEAST Protein transport protein SEC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC24 PE=1 SV=1
13	Q9M291	2.37e-127	422	1096	0.193	0.224	SC24B_ARATH Protein transport protein SEC24 B OS=Arabidopsis thaliana OX=3702 GN=SEC24B PE=2 SV=3
14	C0H5J6	7.23e-126	414	940	0.200	0.269	C0H5J6_PLAF7 Protein transport protein Sec24A OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1361100 PE=4 SV=1
15	P53992	1.93e-125	417	1094	0.237	0.274	SC24C_HUMAN Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3
16	Q8CGF4	9.90e-124	412	1096	0.185	0.214	Q8CGF4_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1
17	G3X972	1.04e-123	412	1096	0.185	0.214	G3X972_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
18	A0A286YDI8	5.92e-123	408	1020	0.185	0.229	A0A286YDI8_MOUSE Sec24 related gene family, member C (S. cerevisiae) OS=Mus musculus OX=10090 GN=Sec24c PE=1 SV=1
19	F1QRB4	7.35e-123	408	1030	0.179	0.220	F1QRB4_DANRE Protein transport protein Sec24D isoform X1 OS=Danio rerio OX=7955 GN=sec24d PE=1 SV=2
20	Q80U83	7.41e-123	408	1028	0.185	0.228	Q80U83_MOUSE MKIAA0079 protein (Fragment) OS=Mus musculus OX=10090 GN=Sec24c PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00626 Gelsolin	9.6e-09	46.4	Gelsolin repeat
2	PF08033 Sec23_BS	1.7e-17	75.2	Sec23/Sec24 beta-sandwich domain
3	PF04815 Sec23_helical	1.1e-23	94.3	Sec23/Sec24 helical domain
4	PF04811 Sec23_trunk	1.9e-82	288.1	Sec23/Sec24 trunk domain
5	PF09631 Sen15	96	14.8	Sen15 protein
6	PF04810 zf-Sec23_Sec24	6.7e-11	53.4	Sec23/Sec24 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428564

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373312	0.999	Protein SEC13 homolog
2	9606.ENSP00000306881	0.998	Protein transport protein Sec23A
3	9606.ENSP00000325827	0.998	Protein transport protein Sec16A
4	9606.ENSP00000378721	0.998	Protein transport protein Sec31A
5	9606.ENSP00000362339	0.995	GTP-binding protein SAR1a
6	9606.ENSP00000294179	0.990	Syntaxin-5
7	9606.ENSP00000338844	0.990	Protein transport protein Sec23B
8	9606.ENSP00000385432	0.990	GTP-binding protein SAR1b
9	9606.ENSP00000260643	0.983	Prolactin regulatory element-binding protein
10	9606.ENSP00000359370	0.978	Protein transport protein Sec31B
11	9606.ENSP00000343405	0.968	Protein transport protein Sec24C
12	9606.ENSP00000280551	0.967	Protein transport protein Sec24D
13	9606.ENSP00000265070	0.964	Golgi phosphoprotein 3
14	9606.ENSP00000222547	0.962	BET1 homolog
15	9606.ENSP00000381823	0.961	Protein transport protein Sec24A
16	9606.ENSP00000251047	0.957	Protein ERGIC-53
17	9606.ENSP00000356230	0.954	Kelch-like protein 12
18	9606.ENSP00000463393	0.953	Vesicle-trafficking protein SEC22b
19	9606.ENSP00000264933	0.943	Programmed cell death protein 6
20	9606.ENSP00000225567	0.937	Golgi SNAP receptor complex member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008270	0.976	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0016043	0.978	cellular component organization
GO:0065007	0.970	biological regulation
GO:0006888	0.925	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0050789	0.922	regulation of biological process
GO:0050794	0.905	regulation of cellular process
GO:0006900	0.885	vesicle budding from membrane
GO:0060341	0.652	regulation of cellular localization
GO:0051049	0.597	regulation of transport
GO:0032501	0.538	multicellular organismal process
GO:0007275	0.507	multicellular organism development
GO:0032386	0.501	regulation of intracellular transport
GO:0043009	0.401	chordate embryonic development
GO:0048731	0.372	system development
GO:0035148	0.359	tube formation
GO:0050793	0.337	regulation of developmental process
GO:0060541	0.330	respiratory system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0030134	1.000	COPII-coated ER to Golgi transport vesicle
GO:0030133	1.000	transport vesicle
GO:0030662	0.999	coated vesicle membrane
GO:0098796	0.993	membrane protein complex
GO:0012507	0.993	ER to Golgi transport vesicle membrane
GO:0030120	0.970	vesicle coat
GO:0030127	0.964	COPII vesicle coat
GO:0005829	0.954	cytosol
GO:0005783	0.903	endoplasmic reticulum
GO:0031984	0.891	organelle subcompartment
GO:0042175	0.888	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.879	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]