StarFunc result for job id O95490

User Input

>input (1459 residues)
MVSSGCRMRSLWFIIVISFLPNTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIE
SANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSDVFPDPCPGTY
KYLEVQYECVPYIFVCPGTLKAIVDSPCIYEAEQKAGAWCKDPLQAADKIYFMPWTPYRT
DTLIEYASLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKS
GEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTLRFEA
TWETVYDKRAASNAFMICGVLYVVRSVYQDNESETGKNSIDYIYNTRLNRGEYVDVPFPN
QYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKTIIST
TSTTSQKGPMSTTVAGSQEGSKGTKPPPAVSTTKIPPITNIFPLPERFCEALDSKGIKWP
QTQRGMMVERPCPKGTRGTASYLCMISTGTWNPKGPDLSNCTSHWVNQLAQKIRSGENAA
SLANELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKLQKREK
TCRAYLKAIVDTVDNLLRPEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTR
VSMPTENIVLEVAVLSTEGQIQDFKFPLGIKGAGSSIQLSANTVKQNSRNGLAKLVFIIY
RSLGQFLSTENATIKLGADFIGRNSTIAVNSHVISVSINKESSRVYLTDPVLFTLPHIDP
DNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKD
GVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIG
IDKTKYAIACPIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLF
PATVVGVSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHS
NTLKPDSSRLENIKSWVLGAFALLCLLGLTWSFGLLFINEETIVMAYLFTIFNAFQGVFI
FIFHCALQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMW
NDTVRKQSESSFISGDINSTSTLNQGMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAP
SAPVFNSPGHSLNNARDTSAMDTLPLNGNFNNSYSLHKGDYNDSVQVVDCGLSLNDTAFE
KMIISELVHNNLRGSSKTHNLELTLPVKPVIGGSSSEDDAIVADASSLMHSDNPGLELHH
KELEAPLIPQRTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHLQSPNRDSLYTSMPNLRD
SPYPESSPDMEEDLSPSRRSENEDIYYKSMPNLGAGHQLQMCYQISRGNSDGYIIPINKE
GCIPEGDVREGQMQLVTSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QM07	0.481	0.458	0.000	1540	0.581	0.551	A0A2R8QM07.pdb.gz	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
2	AFDB:O95490	1.000	1.000	0.000	1459	1.000	1.000	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
3	PDB:5amoB	0.161	0.893	2.945E-23	257	0.068	0.385	5amoB.pdb.gz
4	AFDB:Q4KP33	0.177	0.400	2.178E-21	626	0.103	0.241	Q4KP33.pdb.gz
5	PDB:7tynR	0.159	0.562	1.112E-9	373	0.039	0.153	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
6	PDB:7d3sR	0.155	0.750	1.759E-9	266	0.045	0.244	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
7	PDB:7lciR	0.151	0.507	9.184E-9	393	0.042	0.158	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
8	PDB:7vqxR	0.160	0.570	1.054E-8	361	0.045	0.180	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
9	PDB:6vn7R	0.150	0.728	1.388E-8	263	0.047	0.262	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
10	PDB:7durR	0.157	0.562	1.746E-8	371	0.047	0.183	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
11	PDB:4k5yC	0.149	0.787	2.004E-8	248	0.042	0.246	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
12	PDB:7cz5R	0.150	0.715	4.178E-8	269	0.039	0.212	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
13	PDB:6wpwR	0.162	0.545	7.588E-8	398	0.043	0.158	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
14	AFDB:P23385	0.144	0.170	1.406E-5	1199	0.057	0.069	P23385.pdb.gz	GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1
15	AFDB:A0A0R4IF44	0.134	0.113	7.009E-5	1792	0.099	0.080	A0A0R4IF44.pdb.gz
16	AFDB:X1WE68	0.091	0.059	5.046E-4	2527	0.123	0.071	X1WE68.pdb.gz
17	AFDB:Q8IZD9	0.048	0.036	1.313E-2	2030	0.087	0.063	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
18	AFDB:O00555	0.054	0.036	1.896E-2	2506	0.115	0.067	O00555.pdb.gz	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
19	AFDB:Q9VJ79	0.062	0.062	3.001E-2	1451	0.077	0.077	Q9VJ79.pdb.gz	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
20	AFDB:E9PY61	0.129	0.087	3.775E-2	2293	0.081	0.051	E9PY61.pdb.gz	GP179_MOUSE G-protein coupled receptor 179 OS=Mus musculus OX=10090 GN=Gpr179 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Q6E9	0.0	1576	1492	0.570	0.558	A0A2R8Q6E9_DANRE Adhesion G protein-coupled receptor L3 isoform X5 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
2	A0A2R8QM07	0.0	1640	1540	0.587	0.556	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
3	F1Q579	0.0	1645	1534	0.587	0.559	F1Q579_DANRE Adhesion G protein-coupled receptor L3 isoform X3 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=3
4	O88917	0.0	1926	1515	0.650	0.626	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
5	O88923	0.0	2878	1487	0.948	0.930	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
6	O94910	0.0	1942	1474	0.650	0.643	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
7	O95490	0.0	3051	1459	1.000	1.000	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
8	Q80TR1	0.0	1951	1466	0.650	0.647	AGRL1_MOUSE Adhesion G protein-coupled receptor L1 OS=Mus musculus OX=10090 GN=Adgrl1 PE=1 SV=2
9	Q80TS3	0.0	1771	1537	0.606	0.575	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
10	Q8JZZ7	0.0	2907	1487	0.959	0.941	AGRL2_MOUSE Adhesion G protein-coupled receptor L2 OS=Mus musculus OX=10090 GN=Adgrl2 PE=1 SV=3
11	Q9HAR2	0.0	1752	1447	0.602	0.607	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
12	Q9Z173	0.0	1765	1550	0.607	0.572	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
13	Q9HBW9	3.11e-111	369	690	0.151	0.320	AGRL4_HUMAN Adhesion G protein-coupled receptor L4 OS=Homo sapiens OX=9606 GN=ADGRL4 PE=1 SV=3
14	Q9ESC1	1.29e-106	358	738	0.151	0.299	AGRL4_RAT Adhesion G protein-coupled receptor L4 OS=Rattus norvegicus OX=10116 GN=Adgrl4 PE=1 SV=1
15	G5EDW2	1.84e-89	316	1014	0.138	0.198	LPLT1_CAEEL Latrophilin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=lat-1 PE=1 SV=1
16	G5ECX0	4.05e-76	280	1338	0.108	0.118	LPLT2_CAEEL Latrophilin-like protein LAT-2 OS=Caenorhabditis elegans OX=6239 GN=lat-2 PE=2 SV=1
17	P48960	7.54e-76	272	835	0.105	0.183	AGRE5_HUMAN Adhesion G protein-coupled receptor E5 OS=Homo sapiens OX=9606 GN=ADGRE5 PE=1 SV=4
18	Q5Y4N8	1.51e-75	273	932	0.112	0.176	AGRE1_RAT Adhesion G protein-coupled receptor E2 OS=Rattus norvegicus OX=10116 GN=Adgre1 PE=2 SV=1
19	Q91ZE5	2.28e-75	267	689	0.126	0.267	AGRE4_MOUSE Adhesion G protein-coupled receptor E4 OS=Mus musculus OX=10090 GN=Adgre4 PE=1 SV=1
20	Q61549	2.37e-73	267	931	0.110	0.173	AGRE1_MOUSE Adhesion G protein-coupled receptor E1 OS=Mus musculus OX=10090 GN=Adgre1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	9.3e-66	233.2	7 transmembrane receptor (Secretin family)
2	PF16489 GAIN	5.9e-53	190.9	GPCR-Autoproteolysis INducing (GAIN) domain
3	PF02140 Gal_Lectin	5.6e-20	82.8	Galactose binding lectin domain
4	PF01825 GPS	9.9e-10	50.2	GPCR proteolysis site, GPS, motif
5	PF02793 HRM	2.9e-05	35.6	Hormone receptor domain
6	PF02354 Latrophilin	6.5e-163	553.9	Latrophilin Cytoplasmic C-terminal region
7	PF02191 OLF	1.3e-81	285.4	Olfactomedin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008968767.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008961540.1	0.982	Teneurin-2 isoform X1
2	9597.XP_003810633.1	0.966	Leucine-rich repeat transmembrane protein FLRT3
3	9597.XP_008975338.1	0.900	Teneurin-3 isoform X1
4	9597.XP_008966608.1	0.889	Teneurin transmembrane protein 4
5	9597.XP_008974968.1	0.889	Teneurin-1
6	9597.XP_008974995.1	0.889	Teneurin-1-like
7	9597.XP_003824734.1	0.873	Tenascin N
8	9597.XP_003824735.1	0.873	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 21 ESTs, 20 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
9	9597.XP_003832780.1	0.873	Leucine-rich repeat transmembrane protein FLRT2
10	9597.XP_008956836.1	0.873	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 567 ESTs, 3 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
11	9597.XP_003824845.1	0.863	Wnt inhibitory factor 1
12	9597.XP_008953397.1	0.863	Tenascin XB
13	9597.XP_003825606.1	0.758	Sortilin related VPS10 domain containing receptor 3
14	9597.XP_003806781.1	0.692	Mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
15	9597.XP_003830625.1	0.653	Belongs to the CTL (choline transporter-like) family.
16	9597.XP_003820414.1	0.627	Leucine-rich repeat and transmembrane domain-containing protein 2
17	9597.XP_003830637.1	0.615	Neuronal growth regulator 1
18	9597.XP_008952465.1	0.613	SH3 and multiple ankyrin repeat domains 2
19	9597.XP_008973452.1	0.602	Regulating synaptic membrane exocytosis protein 2 isoform X1
20	9597.XP_008964498.1	0.590	SH3 and multiple ankyrin repeat domains 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005488	0.994	binding
GO:0005515	0.977	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0009987	0.994	cellular process
GO:0050896	0.990	response to stimulus
GO:0032502	0.988	developmental process
GO:0050794	0.986	regulation of cellular process
GO:0007275	0.982	multicellular organism development
GO:0048731	0.961	system development
GO:0051716	0.959	cellular response to stimulus
GO:0007399	0.832	nervous system development
GO:0007154	0.828	cell communication
GO:0023052	0.822	signaling
GO:0007165	0.786	signal transduction
GO:0048869	0.747	cellular developmental process
GO:0030154	0.727	cell differentiation
GO:0071840	0.704	cellular component organization or biogenesis
GO:0007186	0.675	G protein-coupled receptor signaling pathway
GO:0048518	0.641	positive regulation of biological process
GO:0016043	0.635	cellular component organization
GO:0048522	0.578	positive regulation of cellular process
GO:0007155	0.468	cell adhesion
GO:0009653	0.441	anatomical structure morphogenesis
GO:0065008	0.422	regulation of biological quality
GO:0051128	0.421	regulation of cellular component organization
GO:0050793	0.395	regulation of developmental process
GO:0051239	0.386	regulation of multicellular organismal process
GO:2000026	0.381	regulation of multicellular organismal development
GO:0098609	0.377	cell-cell adhesion
GO:0048513	0.338	animal organ development
GO:0042221	0.337	response to chemical
GO:0051960	0.336	regulation of nervous system development
GO:0051130	0.312	positive regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.996	cell periphery
GO:0016020	0.994	membrane
GO:0005886	0.899	plasma membrane
GO:0030054	0.340	cell junction
GO:0045202	0.322	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]