StarFunc result for job id O95498

User Input

>input (520 residues)
MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDI
LETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTP
VQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKY
HLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDTILFPTAWMN
VLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLL
LSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTV
CQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVE
TASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLF
GRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95498	1.000	1.000	0.000	520	1.000	1.000	O95498.pdb.gz	VNN2_HUMAN Pantetheine hydrolase VNN2 OS=Homo sapiens OX=9606 GN=VNN2 PE=1 SV=3
2	AFDB:O95497	0.894	0.906	3.411E-80	513	0.612	0.620	O95497.pdb.gz	VNN1_HUMAN Pantetheinase OS=Homo sapiens OX=9606 GN=VNN1 PE=1 SV=2
3	AFDB:Q9Z0K8	0.892	0.906	6.511E-79	512	0.590	0.600	Q9Z0K8.pdb.gz	VNN1_MOUSE Pantetheinase OS=Mus musculus OX=10090 GN=Vnn1 PE=1 SV=3
4	AFDB:Q9QZ25	0.902	0.937	2.267E-78	500	0.583	0.606	Q9QZ25.pdb.gz	VNN3_MOUSE Vascular non-inflammatory molecule 3 OS=Mus musculus OX=10090 GN=Vnn3 PE=2 SV=3
5	PDB:4cygA	0.875	0.982	5.146E-75	463	0.604	0.678	4cygA.pdb.gz	The Structure of Vanin-1: A Key Enzyme Linking Metabolic Disease and Inflammation
6	AFDB:P43251	0.834	0.799	6.437E-57	543	0.367	0.352	P43251.pdb.gz	BTD_HUMAN Biotinidase OS=Homo sapiens OX=9606 GN=BTD PE=1 SV=2
7	AFDB:Q8CIF4	0.836	0.836	1.688E-56	520	0.363	0.363	Q8CIF4.pdb.gz	BTD_MOUSE Biotinidase OS=Mus musculus OX=10090 GN=Btd PE=1 SV=2
8	AFDB:C6KYS2	0.792	0.821	2.399E-48	501	0.292	0.303	C6KYS2.pdb.gz	SYMPP_STHOU Symplectin OS=Sthenoteuthis oualaniensis OX=34553 GN=sympp PE=1 SV=2
9	AFDB:Q9W430	0.716	0.676	1.956E-37	553	0.246	0.231	Q9W430.pdb.gz	Q9W430_DROME Biotinidase OS=Drosophila melanogaster OX=7227 GN=Btnd PE=2 SV=1
10	PDB:2w1vA	0.379	0.684	2.462E-15	274	0.100	0.190	2w1vA.pdb.gz
11	AFDB:Q10166	0.398	0.624	5.072E-15	322	0.113	0.183	Q10166.pdb.gz	YAUB_SCHPO Hydrolase C26A3.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26A3.11 PE=3 SV=1
12	AFDB:Q9JHW2	0.386	0.702	7.544E-15	276	0.108	0.203	Q9JHW2.pdb.gz	NIT2_MOUSE Omega-amidase NIT2 OS=Mus musculus OX=10090 GN=Nit2 PE=1 SV=1
13	PDB:1emsA	0.381	0.472	1.334E-12	412	0.131	0.165	1emsA.pdb.gz
14	PDB:1f89A	0.387	0.704	4.148E-12	271	0.087	0.166	1f89A.pdb.gz
15	PDB:2uxyA	0.393	0.580	5.204E-12	341	0.075	0.114	2uxyA.pdb.gz
16	PDB:4hg3A	0.365	0.592	9.712E-12	304	0.102	0.174	4hg3A.pdb.gz	Structures of enzyme-intermediate complexes of yeast Nit2: insights into its catalytic mechanism and different substrate specificity compared with mammalian Nit2
17	PDB:2vhiA	0.400	0.584	1.088E-11	348	0.094	0.141	2vhiA.pdb.gz
18	PDB:6ftqA	0.392	0.591	1.290E-11	332	0.092	0.145	6ftqA.pdb.gz
19	PDB:6i00A	0.365	0.632	1.444E-11	289	0.102	0.183	6i00A.pdb.gz
20	PDB:2vhhC	0.407	0.544	1.918E-11	382	0.100	0.136	2vhhC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95497	0.0	678	513	0.621	0.630	VNN1_HUMAN Pantetheinase OS=Homo sapiens OX=9606 GN=VNN1 PE=1 SV=2
2	O95498	0.0	1085	520	1.000	1.000	VNN2_HUMAN Pantetheine hydrolase VNN2 OS=Homo sapiens OX=9606 GN=VNN2 PE=1 SV=3
3	Q9QZ25	0.0	639	500	0.579	0.602	VNN3_MOUSE Vascular non-inflammatory molecule 3 OS=Mus musculus OX=10090 GN=Vnn3 PE=2 SV=3
4	Q9Z0K8	0.0	653	512	0.594	0.604	VNN1_MOUSE Pantetheinase OS=Mus musculus OX=10090 GN=Vnn1 PE=1 SV=3
5	P43251	6.43e-119	362	543	0.375	0.359	BTD_HUMAN Biotinidase OS=Homo sapiens OX=9606 GN=BTD PE=1 SV=2
6	Q8CIF4	4.72e-118	359	520	0.387	0.387	BTD_MOUSE Biotinidase OS=Mus musculus OX=10090 GN=Btd PE=1 SV=2
7	C6KYS2	5.58e-70	234	501	0.300	0.311	SYMPP_STHOU Symplectin OS=Sthenoteuthis oualaniensis OX=34553 GN=sympp PE=1 SV=2
8	Q9W430	3.80e-37	146	553	0.227	0.213	Q9W430_DROME Biotinidase OS=Drosophila melanogaster OX=7227 GN=Btnd PE=2 SV=1
9	H7C579	1.12e-07	55.5	265	0.094	0.185	H7C579_HUMAN Nitrilase family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=8
10	Q9NQR4	2.98e-07	54.3	276	0.094	0.178	NIT2_HUMAN Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1
11	V9HW91	2.98e-07	54.3	276	0.094	0.178	V9HW91_HUMAN Epididymis secretory sperm binding protein Li 8a OS=Homo sapiens OX=9606 GN=HEL-S-8a PE=2 SV=1
12	Q10166	4.07e-06	51.2	322	0.087	0.140	YAUB_SCHPO Hydrolase C26A3.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26A3.11 PE=3 SV=1
13	Q94JV5	2.84e-05	48.5	307	0.102	0.173	NILP2_ARATH Deaminated glutathione amidase, chloroplastic/cytosolic OS=Arabidopsis thaliana OX=3702 GN=NLP2 PE=1 SV=1
14	Q9JHW2	3.65e-05	47.8	276	0.087	0.163	NIT2_MOUSE Omega-amidase NIT2 OS=Mus musculus OX=10090 GN=Nit2 PE=1 SV=1
15	Q8RUF8	5.41e-05	47.8	369	0.087	0.122	NILP3_ARATH Omega-amidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NLP3 PE=1 SV=1
16	P49954	4.61e-04	44.7	291	0.054	0.096	NIT3_YEAST Omega-amidase NIT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIT3 PE=1 SV=1
17	O59829	0.009	40.4	272	0.044	0.085	YCU9_SCHPO Probable nitrilase C965.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.09 PE=3 SV=1
18	Q8VYF5	0.014	40.0	299	0.113	0.197	NILP1_ARATH N-carbamoylputrescine amidase OS=Arabidopsis thaliana OX=3702 GN=CPA PE=1 SV=2
19	O76464	0.015	40.4	460	0.044	0.050	NFT1_DROME Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster OX=7227 GN=NitFhit PE=1 SV=1
20	P47016	0.045	38.5	307	0.060	0.101	NIT2_YEAST Deaminated glutathione amidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00795 CN_hydrolase	2.6e-11	54.9	Carbon-nitrogen hydrolase
2	PF19018 Vanin_C	4.9e-28	109.5	Vanin C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322276

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302108	0.939	Pantothenate kinase 1
2	9606.ENSP00000239231	0.913	Pantothenate kinase 3
3	9606.ENSP00000313377	0.913	Pantothenate kinase 2, mitochondrial
4	9606.ENSP00000356905	0.831	Pantetheinase
5	9606.ENSP00000440594	0.829	Vascular non-inflammatory molecule 3
6	9606.ENSP00000357726	0.771	Protein S100-A12
7	9606.ENSP00000380948	0.712	Integrin beta-2
8	9606.ENSP00000357123	0.700	Myeloid cell nuclear differentiation antigen
9	9606.ENSP00000264260	0.687	Interleukin-18 receptor accessory protein
10	9606.ENSP00000295619	0.684	Prokineticin-2
11	9606.ENSP00000458715	0.611	Caspase recruitment domain-containing protein 14
12	9606.ENSP00000415786	0.608	Glia-derived nexin
13	9606.ENSP00000319635	0.605	C-X-C chemokine receptor type 2
14	9606.ENSP00000236147	0.589	L-selectin
15	9606.ENSP00000235382	0.585	Regulator of G-protein signaling 2
16	9606.ENSP00000356946	0.574	Low affinity immunoglobulin gamma Fc region receptor III-A
17	9606.ENSP00000441691	0.571	Integrin alpha-M
18	9606.ENSP00000357727	0.570	Protein S100-A9
19	9606.ENSP00000219919	0.564	Aquaporin-9
20	9606.ENSP00000444986	0.559	Tyrosine-protein kinase HCK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016811	1.000	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0005488	0.994	binding
GO:0005515	0.978	protein binding
GO:0017159	0.929	pantetheine hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.958	organic substance metabolic process
GO:1901564	0.954	organonitrogen compound metabolic process
GO:0044237	0.947	cellular metabolic process
GO:0006575	0.918	cellular modified amino acid metabolic process
GO:0032787	0.913	monocarboxylic acid metabolic process
GO:0006767	0.874	water-soluble vitamin metabolic process
GO:0043603	0.826	amide metabolic process
GO:0050896	0.580	response to stimulus
GO:0065007	0.387	biological regulation
GO:0050789	0.348	regulation of biological process
GO:0050794	0.319	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.995	extracellular region
GO:0005886	0.995	plasma membrane
GO:0043226	0.925	organelle
GO:0043227	0.922	membrane-bounded organelle
GO:0005622	0.886	intracellular anatomical structure
GO:0005737	0.869	cytoplasm
GO:0043231	0.838	intracellular membrane-bounded organelle
GO:0031982	0.703	vesicle
GO:0030141	0.592	secretory granule
GO:0030659	0.411	cytoplasmic vesicle membrane
GO:0098588	0.340	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	1.000	In linear amides.
RHEA:13445	0.929	(R)-pantetheine + H2O = (R)-pantothenate + cysteamine
EC:3.5.1.92	0.929	pantetheine hydrolase.

[back to server]