StarFunc result for job id O95503

User Input

>input (412 residues)
MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQK
ERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLK
KDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKV
IDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPA
PLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETV
SPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRP
EMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95503	0.999	0.999	6.084E-60	412	1.000	1.000	O95503.pdb.gz	CBX6_HUMAN Chromobox protein homolog 6 OS=Homo sapiens OX=9606 GN=CBX6 PE=1 SV=1
2	AFDB:Q6TKP2	0.216	0.145	7.522E-42	672	0.825	0.506	Q6TKP2.pdb.gz	Q6TKP2_MOUSE Neuronal pentraxin with chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
3	AFDB:X1WBY5	0.239	0.206	1.955E-23	502	0.495	0.406	X1WBY5.pdb.gz	X1WBY5_DANRE Chromobox homolog 6b OS=Danio rerio OX=7955 GN=cbx6b PE=4 SV=1
4	AFDB:Q9HC52	0.175	0.185	8.745E-19	389	0.337	0.357	Q9HC52.pdb.gz	CBX8_HUMAN Chromobox protein homolog 8 OS=Homo sapiens OX=9606 GN=CBX8 PE=1 SV=3
5	AFDB:A8KC45	0.181	0.205	6.339E-18	361	0.301	0.343	A8KC45.pdb.gz
6	AFDB:Q4FZS1	0.178	0.199	7.633E-18	366	0.323	0.363	Q4FZS1.pdb.gz
7	AFDB:P30658	0.166	0.133	3.818E-12	519	0.320	0.254	P30658.pdb.gz	CBX2_MOUSE Chromobox protein homolog 2 OS=Mus musculus OX=10090 GN=Cbx2 PE=1 SV=2
8	AFDB:Q14781	0.167	0.131	4.062E-12	532	0.320	0.248	Q14781.pdb.gz	CBX2_HUMAN Chromobox protein homolog 2 OS=Homo sapiens OX=9606 GN=CBX2 PE=1 SV=2
9	AFDB:P26017	0.150	0.158	9.082E-12	390	0.201	0.213	P26017.pdb.gz	PC_DROME Polycomb group protein Pc OS=Drosophila melanogaster OX=7227 GN=Pc PE=1 SV=1
10	AFDB:A0A0S2Z5B2	0.168	0.126	3.502E-10	560	0.313	0.230	A0A0S2Z5B2.pdb.gz	A0A0S2Z5B2_HUMAN Chromobox homolog 4 (Pc class homolog, Drosophila), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=CBX4 PE=2 SV=1
11	PDB:6g0lM	0.128	0.066	4.412E-2	855	0.034	0.016	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:2iw3B	0.119	0.051	8.716E-2	980	0.032	0.013	2iw3B.pdb.gz	Structure of Eef3 and the Mechanism of Transfer RNA Release from the E-Site.
13	PDB:6g0lW	0.119	0.059	1.188E-1	878	0.044	0.021	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
14	PDB:1ak5A	0.072	0.088	8.610E-1	329	0.012	0.015	1ak5A.pdb.gz
15	PDB:4iluA	0.077	0.164	9.745E-1	165	0.046	0.115	4iluA.pdb.gz
16	PDB:6v8oO	0.066	0.070	1.413	384	0.056	0.060	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
17	PDB:1mjfA	0.075	0.111	1.503	271	0.010	0.015	1mjfA.pdb.gz
18	PDB:7ae1M	0.064	0.066	1.599	400	0.046	0.048	7ae1M.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
19	PDB:3o4fC	0.070	0.098	1.925	284	0.005	0.007	3o4fC.pdb.gz
20	PDB:3pvuA	0.076	0.055	2.791	609	0.024	0.016	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95503	0.0	814	412	1.000	1.000	CBX6_HUMAN Chromobox protein homolog 6 OS=Homo sapiens OX=9606 GN=CBX6 PE=1 SV=1
2	Q6TKP2	0.0	665	672	0.830	0.509	Q6TKP2_MOUSE Neuronal pentraxin with chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
3	Q9DBY5	0.0	687	414	0.852	0.848	CBX6_MOUSE Chromobox protein homolog 6 OS=Mus musculus OX=10090 GN=Cbx6 PE=1 SV=2
4	Q6TLW0	1.73e-122	365	469	0.434	0.382	Q6TLW0_MOUSE Neuronal pentraxin 1.4 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
5	F8VQB8	2.42e-122	364	469	0.434	0.382	F8VQB8_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
6	X1WBY5	4.21e-87	275	502	0.357	0.293	X1WBY5_DANRE Chromobox homolog 6b OS=Danio rerio OX=7955 GN=cbx6b PE=4 SV=1
7	Q6TLW1	3.95e-49	172	372	0.199	0.220	Q6TLW1_MOUSE Neuronal pentraxin 1.1 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
8	H3BLN6	4.77e-49	172	372	0.199	0.220	H3BLN6_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
9	Q9QXV1	5.98e-43	155	362	0.170	0.193	CBX8_MOUSE Chromobox protein homolog 8 OS=Mus musculus OX=10090 GN=Cbx8 PE=1 SV=1
10	Q9HC52	2.59e-42	155	389	0.170	0.180	CBX8_HUMAN Chromobox protein homolog 8 OS=Homo sapiens OX=9606 GN=CBX8 PE=1 SV=3
11	Q502N4	6.57e-37	139	361	0.175	0.199	Q502N4_DANRE Chromobox homolog 8b OS=Danio rerio OX=7955 GN=zgc:111978 PE=2 SV=1
12	Q05BI5	1.72e-32	125	258	0.155	0.248	Q05BI5_MOUSE Cbx4 protein (Fragment) OS=Mus musculus OX=10090 GN=Cbx4 PE=2 SV=1
13	P60889	1.40e-31	119	158	0.138	0.361	CBX7_RAT Chromobox protein homolog 7 OS=Rattus norvegicus OX=10116 GN=Cbx7 PE=2 SV=1
14	A0A0S2Z5B2	6.28e-31	126	560	0.158	0.116	A0A0S2Z5B2_HUMAN Chromobox homolog 4 (Pc class homolog, Drosophila), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=CBX4 PE=2 SV=1
15	O00257	6.28e-31	126	560	0.158	0.116	CBX4_HUMAN E3 SUMO-protein ligase CBX4 OS=Homo sapiens OX=9606 GN=CBX4 PE=1 SV=3
16	O55187	9.63e-31	125	551	0.150	0.113	CBX4_MOUSE E3 SUMO-protein ligase CBX4 OS=Mus musculus OX=10090 GN=Cbx4 PE=1 SV=2
17	Q8VDS3	1.20e-30	117	158	0.133	0.348	CBX7_MOUSE Chromobox protein homolog 7 OS=Mus musculus OX=10090 GN=Cbx7 PE=1 SV=1
18	O95931	5.49e-30	118	251	0.143	0.235	CBX7_HUMAN Chromobox protein homolog 7 OS=Homo sapiens OX=9606 GN=CBX7 PE=1 SV=1
19	A0A8I5ZMG5	5.40e-28	116	404	0.121	0.124	A0A8I5ZMG5_RAT Chromobox 8 OS=Rattus norvegicus OX=10116 GN=Cbx8 PE=4 SV=1
20	Q14781	6.24e-24	105	532	0.102	0.079	CBX2_HUMAN Chromobox protein homolog 2 OS=Homo sapiens OX=9606 GN=CBX2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17218 CBX7_C	3.8e-11	53.8	CBX family C-terminal motif
2	PF00385 Chromo	3.3e-12	57.4	Chromo (CHRromatin Organisation MOdifier) domain
3	PF14061 Mtf2_C	72	15.0	Polycomb-like MTF2 factor 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257118	0.998	Polyhomeotic-like protein 2
2	9606.ENSP00000356480	0.998	E3 ubiquitin-protein ligase RING2
3	9606.ENSP00000363787	0.997	E3 ubiquitin-protein ligase RING1
4	9606.ENSP00000365851	0.995	Polycomb complex protein BMI-1
5	9606.ENSP00000420294	0.993	Polyhomeotic-like protein 3
6	9606.ENSP00000440674	0.988	Polyhomeotic-like protein 1
7	9606.ENSP00000482063	0.986	Polycomb group RING finger protein 2
8	9606.ENSP00000473391	0.983	annotation not available
9	9606.ENSP00000358862	0.981	Polycomb group RING finger protein 6
10	9606.ENSP00000233630	0.977	Polycomb group RING finger protein 1
11	9606.ENSP00000251900	0.976	Sex comb on midleg-like protein 2
12	9606.ENSP00000354724	0.971	Polycomb group RING finger protein 3
13	9606.ENSP00000320147	0.968	Histone-lysine N-methyltransferase EZH2
14	9606.ENSP00000404658	0.968	Histone-lysine N-methyltransferase EZH1
15	9606.ENSP00000445704	0.967	Polycomb group RING finger protein 5
16	9606.ENSP00000263360	0.963	Polycomb protein EED
17	9606.ENSP00000269385	0.956	Chromobox protein homolog 8
18	9606.ENSP00000316578	0.953	Polycomb protein SUZ12
19	9606.ENSP00000355657	0.949	Histone H3.1t
20	9606.ENSP00000269397	0.947	E3 SUMO-protein ligase CBX4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.818	heterocyclic compound binding
GO:0003676	0.807	nucleic acid binding
GO:0003682	0.444	chromatin binding
GO:0043565	0.413	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0080090	0.984	regulation of primary metabolic process
GO:0051171	0.983	regulation of nitrogen compound metabolic process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0048519	0.966	negative regulation of biological process
GO:0019219	0.962	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.956	negative regulation of cellular process
GO:0009889	0.953	regulation of biosynthetic process
GO:0051252	0.944	regulation of RNA metabolic process
GO:0031326	0.937	regulation of cellular biosynthetic process
GO:0010556	0.936	regulation of macromolecule biosynthetic process
GO:0009892	0.932	negative regulation of metabolic process
GO:2001141	0.927	regulation of RNA biosynthetic process
GO:0051172	0.923	negative regulation of nitrogen compound metabolic process
GO:0010605	0.922	negative regulation of macromolecule metabolic process
GO:0006355	0.922	regulation of DNA-templated transcription
GO:0031324	0.915	negative regulation of cellular metabolic process
GO:0006357	0.907	regulation of transcription by RNA polymerase II
GO:0045892	0.906	negative regulation of DNA-templated transcription
GO:0000122	0.876	negative regulation of transcription by RNA polymerase II
GO:0009987	0.674	cellular process
GO:0008152	0.417	metabolic process
GO:0071704	0.393	organic substance metabolic process
GO:0044238	0.369	primary metabolic process
GO:0006807	0.345	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.995	nuclear protein-containing complex
GO:0031519	0.994	PcG protein complex
GO:0043232	0.925	intracellular non-membrane-bounded organelle
GO:0000785	0.815	chromatin
GO:0005737	0.646	cytoplasm
GO:1902494	0.594	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]