StarFunc result for job id O95521

User Input

>input (474 residues)
MSIQAPPRLLELAGQSLLRDQALSISAMEELPRVLYLPLFMEAFSRRHFQTLTVMVQAWP
FTCLPLGSLMKTLHLETLKALLEGLHMLLTQKDRPRRWKLQVLDLRDVDENFWARWPGAW
ALSCFPETTSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYLFQWVYQRRGLVHL
CCSKLVNYLTPIKYLRKSLKIIYLNSIQELEIRNMSWPRLIRKLRCYLKEMKNLRKLVFS
RCHHYTSDNELEGRLVAKFSSVFLRLEHLQLLKIKLITFFSGHLEQLIRCLQNPLENLEL
TYGYLLEEDMKCLSQYPSLGYLKHLNLSYVLLFRISLEPLGALLEKIAASLKTLILEGCQ
IHYSQLSAILPGLSRCSQLTTFYFGRNCMSIDALKDLLRHTSGLSKLSLETYPAPEESLN
SLVRVNWEIFTPLRAELMCTLREVRQPKRIFIGPTPCPSCGSSPSEELELHLCC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DUQ2	0.884	0.877	4.127E-48	478	0.487	0.483	P0DUQ2.pdb.gz	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
2	AFDB:A0A024R1E6	0.864	0.807	5.767E-44	509	0.454	0.422	A0A024R1E6.pdb.gz
3	AFDB:E9Q5G7	0.809	0.776	2.136E-36	496	0.359	0.343	E9Q5G7.pdb.gz	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
4	AFDB:Q810Y8	0.817	0.809	2.261E-35	479	0.316	0.313	Q810Y8.pdb.gz	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
5	AFDB:Q99MW3	0.758	0.782	1.931E-34	458	0.342	0.354	Q99MW3.pdb.gz	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
6	AFDB:Q15048	0.559	0.540	4.979E-23	493	0.251	0.241	Q15048.pdb.gz	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
7	AFDB:Q9NPP4	0.398	0.215	1.103E-8	1024	0.173	0.080	Q9NPP4.pdb.gz	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
8	AFDB:Q3UP24	0.391	0.214	2.215E-8	1024	0.156	0.072	Q3UP24.pdb.gz	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
9	PDB:4kxfP	0.389	0.238	9.689E-8	866	0.154	0.084	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
10	AFDB:Q86WI3	0.396	0.124	1.236E-6	1866	0.150	0.038	Q86WI3.pdb.gz	NLRC5_HUMAN Protein NLRC5 OS=Homo sapiens OX=9606 GN=NLRC5 PE=1 SV=3
11	AFDB:Q8BFZ4	0.375	0.401	1.898E-6	434	0.148	0.161	Q8BFZ4.pdb.gz	FXL21_MOUSE F-box/LRR-repeat protein 21 OS=Mus musculus OX=10090 GN=Fbxl21 PE=1 SV=1
12	PDB:3jblA	0.341	0.206	2.841E-6	909	0.150	0.078	3jblA.pdb.gz
13	PDB:4i6jB	0.315	0.364	7.869E-6	394	0.108	0.129	4i6jB.pdb.gz
14	PDB:7sa1B	0.376	0.301	1.580E-5	624	0.131	0.099	7sa1B.pdb.gz
15	PDB:7pmkL	0.392	0.391	1.667E-5	475	0.124	0.124	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:3oglB	0.371	0.319	8.329E-5	568	0.122	0.102	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
17	PDB:6hkwA	0.306	0.433	8.329E-5	306	0.105	0.163	6hkwA.pdb.gz
18	PDB:5hzgB	0.362	0.292	9.272E-5	615	0.091	0.070	5hzgB.pdb.gz	DWARF14 is a non-canonical hormone receptor for strigolactone
19	PDB:7pzcA	0.410	0.213	9.783E-5	1010	0.146	0.068	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
20	PDB:1m9sA	0.170	0.158	1.672E-4	523	0.080	0.073	1m9sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DUQ2	2.57e-136	403	478	0.492	0.487	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
2	Q5VXH4	3.29e-136	402	476	0.489	0.487	PRAM6_HUMAN PRAME family member 6 OS=Homo sapiens OX=9606 GN=PRAMEF6 PE=1 SV=1
3	P78395	2.60e-109	335	509	0.464	0.432	PRAME_HUMAN Melanoma antigen preferentially expressed in tumors OS=Homo sapiens OX=9606 GN=PRAME PE=1 SV=1
4	Q99MW3	5.72e-82	263	458	0.346	0.358	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
5	Q810Y8	1.63e-73	241	479	0.314	0.311	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
6	E9Q5G7	4.39e-68	228	496	0.369	0.353	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
7	Q15048	1.65e-24	108	493	0.249	0.239	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
8	B3U3W0	0.049	38.5	750	0.101	0.064	B3U3W0_DANRE Toll-like receptor 4a OS=Danio rerio OX=7955 GN=TIR4.1 PE=2 SV=1
9	Q9BUY7	0.21	35.4	163	0.061	0.178	EFC11_HUMAN EF-hand calcium-binding domain-containing protein 11 OS=Homo sapiens OX=9606 GN=EFCAB11 PE=1 SV=1
10	Q570C0	1.8	33.5	594	0.095	0.076	TIR1_ARATH Protein TRANSPORT INHIBITOR RESPONSE 1 OS=Arabidopsis thaliana OX=3702 GN=TIR1 PE=1 SV=2
11	O14006	7.2	31.2	271	0.042	0.074	RT09_SCHPO Small ribosomal subunit protein uS9m OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrps9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321963	0.622	Zinc finger and SCAN domain-containing protein 4
2	9606.ENSP00000272395	0.611	Tripartite motif containing 43
3	9606.ENSP00000370800	0.593	methyl-CpG binding domain protein 3 like 2
4	9606.ENSP00000373196	0.557	Olfactory receptor 5H6
5	9606.ENSP00000380053	0.538	PRD class homeoboxes and pseudogenes
6	9606.ENSP00000458065	0.524	Double homeobox protein 4
7	9606.ENSP00000359415	0.517	Putative KHDC1-like protein
8	9606.ENSP00000451411	0.506	Double homeobox 4 like 7
9	9606.ENSP00000452398	0.504	Double homeobox protein A
10	9606.ENSP00000485452	0.504	Double homeodomain protein DUX4-s

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990756	0.999	ubiquitin ligase-substrate adaptor activity
GO:0005515	0.992	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044265	0.998	cellular macromolecule catabolic process
GO:0051603	0.998	proteolysis involved in protein catabolic process
GO:0019941	0.885	modification-dependent protein catabolic process
GO:0006511	0.882	ubiquitin-dependent protein catabolic process
GO:0065007	0.828	biological regulation
GO:0050794	0.808	regulation of cellular process
GO:0010498	0.590	proteasomal protein catabolic process
GO:0043161	0.574	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0048583	0.353	regulation of response to stimulus
GO:0023051	0.336	regulation of signaling
GO:0010646	0.336	regulation of cell communication
GO:0009966	0.331	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005622	0.988	intracellular anatomical structure
GO:0005634	0.984	nucleus
GO:0031981	0.906	nuclear lumen
GO:0032991	0.857	protein-containing complex
GO:0005737	0.855	cytoplasm
GO:0005654	0.848	nucleoplasm
GO:0016020	0.728	membrane
GO:0071944	0.690	cell periphery
GO:0005886	0.457	plasma membrane
GO:0012505	0.322	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]