StarFunc result for job id O95522

User Input

>input (483 residues)
MSLQAPPRLLELAEQSLLRDRALAIPTLEELPRELFPPLFMEAFTRRCCETLTTMVQAWP
FTCLPLGSLMKSCNLEIFRAVLEGLDALLAQKVRPRRWKLQVLDLRNVDENFWGIWSGAS
ALSPEALSKRRTAGNCPRPGGQQPLMVILDLCFKNGTLDECLTHFLEWGKQRKGLLHVCC
KELQIFGIAIHRIIEVLNTVELDCIQEVEVCCPWELSILIRFAPYLGQMRNLRKLVLFNI
HVSACIPLDRKEQFVIQFTSQFLKLDYFQKLYMHSVSFLEGHLDQLLRCLQAPLETVVMT
ECLLSESDLKHLSWCPSIRQLKELDLRGITLTHFSPEPLSVLLEQAEATLQTLDLEDCGI
VDSQLSAILPALSRCSQLSTFSFCGNLISMAALENLLRHTVGLSKLSLELYPAPLESYDA
QGALCWGRFSQLGAELMKTLRDLRQPKIIVFSTVPCPRCGIRASYDLEPSHCLLNACCQG
GFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DUQ2	0.909	0.918	4.052E-58	478	0.607	0.613	P0DUQ2.pdb.gz	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
2	AFDB:A0A024R1E6	0.886	0.842	9.089E-50	509	0.528	0.501	A0A024R1E6.pdb.gz
3	AFDB:Q810Y8	0.835	0.841	9.671E-42	479	0.354	0.357	Q810Y8.pdb.gz	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
4	AFDB:E9Q5G7	0.800	0.780	3.430E-40	496	0.402	0.391	E9Q5G7.pdb.gz	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
5	AFDB:Q99MW3	0.742	0.781	1.428E-38	458	0.364	0.384	Q99MW3.pdb.gz	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
6	AFDB:Q15048	0.568	0.559	1.911E-27	493	0.265	0.260	Q15048.pdb.gz	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
7	AFDB:Q3UP24	0.421	0.233	9.117E-11	1024	0.145	0.068	Q3UP24.pdb.gz	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
8	AFDB:P59047	0.391	0.181	1.362E-8	1200	0.151	0.061	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
9	AFDB:Q9NPP4	0.397	0.220	2.448E-8	1024	0.155	0.073	Q9NPP4.pdb.gz	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
10	PDB:4kxfP	0.373	0.229	5.872E-8	866	0.153	0.085	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
11	AFDB:Q08496	0.380	0.278	1.853E-7	732	0.153	0.101	Q08496.pdb.gz	DIA2_YEAST Protein DIA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIA2 PE=1 SV=2
12	PDB:1a4yA	0.379	0.395	2.474E-7	460	0.139	0.146	1a4yA.pdb.gz
13	PDB:3jblA	0.394	0.239	2.902E-7	909	0.137	0.073	3jblA.pdb.gz
14	PDB:7pmkL	0.382	0.387	4.884E-6	475	0.130	0.133	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:6o60C	0.392	0.470	8.775E-6	389	0.139	0.172	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
16	PDB:4i6jB	0.317	0.369	2.546E-5	394	0.120	0.147	4i6jB.pdb.gz
17	PDB:2p1nB	0.249	0.223	2.685E-5	571	0.118	0.100	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
18	PDB:7pzcA	0.422	0.224	3.151E-5	1010	0.112	0.053	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
19	PDB:3oglB	0.357	0.312	7.005E-5	568	0.108	0.092	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
20	PDB:6hkwA	0.228	0.330	3.283E-4	306	0.077	0.121	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DUQ2	0.0	568	478	0.611	0.617	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
2	Q5VXH4	0.0	569	476	0.619	0.628	PRAM6_HUMAN PRAME family member 6 OS=Homo sapiens OX=9606 GN=PRAMEF6 PE=1 SV=1
3	P78395	1.05e-156	456	509	0.528	0.501	PRAME_HUMAN Melanoma antigen preferentially expressed in tumors OS=Homo sapiens OX=9606 GN=PRAME PE=1 SV=1
4	Q99MW3	1.57e-98	306	458	0.366	0.386	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
5	E9Q5G7	2.48e-98	306	496	0.404	0.393	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
6	Q810Y8	3.57e-90	285	479	0.348	0.351	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
7	Q15048	6.45e-40	152	493	0.277	0.272	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
8	Q9CZS3	0.019	38.5	174	0.060	0.167	CEP20_MOUSE Centrosomal protein 20 OS=Mus musculus OX=10090 GN=Cep20 PE=1 SV=1
9	Q385R4	0.12	37.4	440	0.064	0.070	Q385R4_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2690 PE=4 SV=1
10	Q9C000	0.24	36.6	1473	0.068	0.022	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
11	Q9LR04	0.32	36.2	1140	0.099	0.042	Q9LR04_ARATH F10A5.16 OS=Arabidopsis thaliana OX=3702 GN=MUS PE=1 SV=1
12	P59047	0.77	35.0	1200	0.060	0.024	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
13	D9I2G3	0.78	35.0	1218	0.052	0.021	NL1A2_RAT NACHT, LRR and PYD domains-containing protein 1 allele 2 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
14	D9I2F9	0.79	35.0	1218	0.052	0.021	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
15	D9I2G4	0.80	35.0	1218	0.052	0.021	NL1A5_RAT NACHT, LRR and PYD domains-containing protein 1a allele 5 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
16	D9I2G1	0.82	35.0	1218	0.052	0.021	NL1A4_RAT NACHT, LRR and PYD domains-containing protein 1a allele 4 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
17	D9I2H0	0.85	34.7	1218	0.052	0.021	NL1A3_RAT NACHT, LRR and PYD domains-containing protein 1a allele 3 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
18	Q8BHK3	1.3	33.9	478	0.056	0.056	S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc36a2 PE=1 SV=1
19	Q7Z7A3	1.4	33.9	348	0.033	0.046	CTU1_HUMAN Cytoplasmic tRNA 2-thiolation protein 1 OS=Homo sapiens OX=9606 GN=CTU1 PE=1 SV=1
20	Q2LKU9	1.5	33.9	1182	0.072	0.030	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	5e+02	12.7	Leucine Rich Repeat
2	PF12799 LRR_4	6.6	18.6	Leucine Rich repeats (2 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350358

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370800	0.636	methyl-CpG binding domain protein 3 like 2
2	9606.ENSP00000272395	0.578	Tripartite motif containing 43
3	9606.ENSP00000308292	0.561	Protein FAM170B
4	9606.ENSP00000359415	0.522	Putative KHDC1-like protein
5	9606.ENSP00000437968	0.504	HEAT repeat-containing protein 5A
6	9606.ENSP00000386166	0.500	Proline rich 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990756	1.000	ubiquitin ligase-substrate adaptor activity
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006511	0.999	ubiquitin-dependent protein catabolic process
GO:0010498	0.997	proteasomal protein catabolic process
GO:0043161	0.946	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0065007	0.771	biological regulation
GO:0050794	0.419	regulation of cellular process
GO:0019222	0.375	regulation of metabolic process
GO:0060255	0.368	regulation of macromolecule metabolic process
GO:0051171	0.347	regulation of nitrogen compound metabolic process
GO:0031323	0.342	regulation of cellular metabolic process
GO:0080090	0.341	regulation of primary metabolic process
GO:0048518	0.338	positive regulation of biological process
GO:0048522	0.313	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0016020	0.980	membrane
GO:0005622	0.973	intracellular anatomical structure
GO:0043231	0.937	intracellular membrane-bounded organelle
GO:0005886	0.926	plasma membrane
GO:0005634	0.921	nucleus
GO:0032991	0.914	protein-containing complex
GO:0031462	0.810	Cul2-RING ubiquitin ligase complex
GO:0005737	0.788	cytoplasm
GO:0005654	0.707	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]