StarFunc result for job id O95528

User Input

>input (541 residues)
MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL
ASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACC
IYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSL
SLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRGRTTVGLGLVL
FQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALL
LAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPIPRTN
EDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFL
LYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAA
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95528	1.000	1.000	1.290E-69	541	1.000	1.000	O95528.pdb.gz	GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens OX=9606 GN=SLC2A10 PE=1 SV=2
2	AFDB:Q8VHD6	0.798	0.805	2.169E-50	536	0.774	0.782	Q8VHD6.pdb.gz	GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus OX=10090 GN=Slc2a10 PE=2 SV=1
3	AFDB:F1R0H0	0.748	0.788	4.244E-36	513	0.447	0.472	F1R0H0.pdb.gz	GTR10_DANRE Solute carrier family 2, facilitated glucose transporter member 10 OS=Danio rerio OX=7955 GN=slc2a10 PE=2 SV=1
4	AFDB:Q8TD20	0.755	0.666	7.154E-31	617	0.390	0.342	Q8TD20.pdb.gz	GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens OX=9606 GN=SLC2A12 PE=2 SV=1
5	AFDB:Q8BFW9	0.775	0.678	1.185E-30	622	0.396	0.344	Q8BFW9.pdb.gz	GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus OX=10090 GN=Slc2a12 PE=2 SV=1
6	AFDB:Q6NWF1	0.759	0.678	7.640E-29	610	0.375	0.333	Q6NWF1.pdb.gz	GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio OX=7955 GN=slc2a12 PE=2 SV=2
7	AFDB:X1WEW2	0.713	0.653	3.688E-23	593	0.298	0.272	X1WEW2.pdb.gz
8	AFDB:Q8VZR6	0.721	0.764	1.608E-22	509	0.272	0.289	Q8VZR6.pdb.gz	INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana OX=3702 GN=INT1 PE=1 SV=1
9	AFDB:Q385N3	0.701	0.782	7.317E-22	483	0.227	0.255	Q385N3.pdb.gz	Q385N3_TRYB2 Sugar transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3020 PE=3 SV=1
10	AFDB:Q8VZ80	0.704	0.706	1.264E-21	539	0.242	0.243	Q8VZ80.pdb.gz	PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana OX=3702 GN=PLT5 PE=1 SV=2
11	PDB:7sptA	0.680	0.776	3.570E-18	470	0.220	0.253	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
12	PDB:7wsmA	0.678	0.785	2.840E-16	464	0.231	0.269	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
13	PDB:7aaqA	0.672	0.741	7.168E-16	487	0.231	0.257	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
14	PDB:6thaA	0.662	0.788	2.233E-15	448	0.216	0.261	6thaA.pdb.gz
15	PDB:4gbyA	0.639	0.722	2.329E-15	475	0.248	0.282	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:4ybqB	0.646	0.746	3.164E-14	462	0.229	0.268	4ybqB.pdb.gz
17	PDB:4ja4A	0.603	0.730	1.166E-13	442	0.244	0.299	4ja4A.pdb.gz
18	PDB:7zh0A	0.586	0.634	3.764E-10	495	0.176	0.192	7zh0A.pdb.gz
19	PDB:6oopA	0.577	0.766	4.373E-8	392	0.140	0.194	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
20	PDB:6kkkA	0.560	0.764	9.049E-7	381	0.129	0.184	6kkkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95528	0.0	1067	541	1.000	1.000	GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens OX=9606 GN=SLC2A10 PE=1 SV=2
2	Q8VHD6	0.0	746	536	0.774	0.782	GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus OX=10090 GN=Slc2a10 PE=2 SV=1
3	F1R0H0	7.96e-142	421	513	0.449	0.474	GTR10_DANRE Solute carrier family 2, facilitated glucose transporter member 10 OS=Danio rerio OX=7955 GN=slc2a10 PE=2 SV=1
4	Q8TD20	2.10e-113	351	617	0.397	0.348	GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens OX=9606 GN=SLC2A12 PE=2 SV=1
5	Q8BFW9	2.52e-113	351	622	0.399	0.347	GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus OX=10090 GN=Slc2a12 PE=2 SV=1
6	Q6NWF1	6.06e-89	287	610	0.410	0.364	GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio OX=7955 GN=slc2a12 PE=2 SV=2
7	Q9C757	2.05e-53	192	580	0.314	0.293	INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana OX=3702 GN=INT2 PE=1 SV=1
8	Q96QE2	1.46e-50	186	648	0.309	0.258	MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC2A13 PE=1 SV=3
9	Q9XXR3	7.64e-46	172	606	0.279	0.249	HMT11_CAEEL Proton myo-inositol cotransporter hmit-1.1 OS=Caenorhabditis elegans OX=6239 GN=hmit-1.1 PE=2 SV=1
10	Q921A2	1.78e-45	171	637	0.303	0.257	MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus OX=10116 GN=Slc2a13 PE=1 SV=2
11	O23492	2.48e-45	170	582	0.296	0.275	INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana OX=3702 GN=INT4 PE=1 SV=1
12	Q3UHK1	5.67e-44	167	637	0.305	0.259	MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus OX=10090 GN=Slc2a13 PE=1 SV=2
13	C3RUD8	4.51e-40	154	546	0.281	0.278	C3RUD8_DANRE Glucose transporter 13a OS=Danio rerio OX=7955 GN=slc2a13a PE=2 SV=1
14	Q21455	1.96e-38	150	604	0.296	0.265	HMT13_CAEEL Proton myo-inositol cotransporter hmit-1.3 OS=Caenorhabditis elegans OX=6239 GN=hmit-1.3 PE=2 SV=3
15	P87110	2.16e-36	144	557	0.200	0.194	ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=itr2 PE=2 SV=1
16	Q9XXQ9	5.80e-34	138	613	0.281	0.248	HMT12_CAEEL Proton myo-inositol cotransporter hmit-1.2 OS=Caenorhabditis elegans OX=6239 GN=hmit-1.2 PE=2 SV=1
17	Q0WWW9	1.22e-33	136	558	0.207	0.201	XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g59250 PE=1 SV=2
18	Q56ZZ7	1.37e-32	133	546	0.203	0.201	PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana OX=3702 GN=At5g16150 PE=1 SV=2
19	A0A1D8PH98	6.49e-32	131	554	0.190	0.186	ITR1_CANAL Myo-inositol transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ITR1 PE=1 SV=1
20	Q8VZR6	1.10e-31	130	509	0.198	0.210	INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana OX=3702 GN=INT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	3.2e-24	97.1	Major Facilitator Superfamily
2	PF00083 Sugar_tr	1.4e-67	240.2	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352216

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379008	0.731	Sodium/glucose cotransporter 5
2	9606.ENSP00000272424	0.694	EKC/KEOPS complex subunit TPRKB
3	9606.ENSP00000325527	0.693	Fibrillin-1
4	9606.ENSP00000309953	0.671	EGF containing fibulin extracellular matrix protein 2
5	9606.ENSP00000402373	0.648	Actin, aortic smooth muscle
6	9606.ENSP00000457230	0.640	WW domain-containing oxidoreductase
7	9606.ENSP00000379616	0.612	Myosin-11
8	9606.ENSP00000424571	0.608	Fibrillin-2
9	9606.ENSP00000360252	0.600	Protein Hook homolog 1
10	9606.ENSP00000304408	0.589	Collagen alpha-1(III) chain
11	9606.ENSP00000364133	0.585	TGF-beta receptor type-1
12	9606.ENSP00000351905	0.573	TGF-beta receptor type-2
13	9606.ENSP00000400325	0.570	Uncharacterized protein
14	9606.ENSP00000472474	0.570	L-amino-acid oxidase
15	9606.ENSP00000244043	0.552	Prostacyclin synthase
16	9606.ENSP00000353452	0.529	Myosin light chain kinase, smooth muscle
17	9606.ENSP00000364000	0.526	Collagen alpha-2(V) chain
18	9606.ENSP00000363092	0.516	cGMP-dependent protein kinase 1
19	9606.ENSP00000332973	0.507	Mothers against decapentaplegic homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008514	0.998	organic anion transmembrane transporter activity
GO:0055056	0.996	D-glucose transmembrane transporter activity
GO:0090482	0.995	vitamin transmembrane transporter activity
GO:0005515	0.816	protein binding
GO:0015318	0.325	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0008643	0.995	carbohydrate transport
GO:0008645	0.993	hexose transmembrane transport
GO:1904659	0.902	glucose transmembrane transport
GO:0065007	0.475	biological regulation
GO:0050789	0.393	regulation of biological process
GO:0050794	0.372	regulation of cellular process
GO:0008152	0.312	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.975	cytosol
GO:0043226	0.820	organelle
GO:0043227	0.811	membrane-bounded organelle
GO:0043231	0.773	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]