StarFunc result for job id O95544

User Input

>input (446 residues)
MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFR
RTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQ
PFKELCTHLMEENMIVYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIIC
LGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRL
KVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVD
VYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVV
PAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFES
LAQCLHWNVRKKQAHFEEEEEEEEEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5FVF8	0.757	0.742	8.661E-77	455	0.910	0.892	Q5FVF8.pdb.gz	Q5FVF8_RAT NAD(+) kinase OS=Rattus norvegicus OX=10116 GN=Nadk PE=2 SV=1
2	AFDB:Q6IDH2	0.760	0.621	1.834E-59	548	0.527	0.429	Q6IDH2.pdb.gz	Q6IDH2_DROME NAD(+) kinase OS=Drosophila melanogaster OX=7227 GN=Nadk1a PE=1 SV=1
3	AFDB:F4HY34	0.663	0.305	1.127E-42	999	0.365	0.163	F4HY34.pdb.gz	F4HY34_ARATH NAD kinase 2 OS=Arabidopsis thaliana OX=3702 GN=NADK2 PE=1 SV=1
4	AFDB:F4IWD3	0.681	0.637	3.240E-41	479	0.325	0.303	F4IWD3.pdb.gz	F4IWD3_ARATH NAD kinase 1 OS=Arabidopsis thaliana OX=3702 GN=NADK1 PE=1 SV=2
5	AFDB:P32622	0.664	0.600	1.174E-38	495	0.314	0.283	P32622.pdb.gz	YEF1_YEAST ATP-NADH kinase YEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEF1 PE=1 SV=1
6	AFDB:P21373	0.658	0.557	7.740E-38	530	0.287	0.242	P21373.pdb.gz	UTR1_YEAST NAD(+) kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR1 PE=1 SV=2
7	AFDB:Q6LA56	0.626	0.707	1.304E-35	393	0.265	0.300	Q6LA56.pdb.gz	YF4B_SCHPO Uncharacterized kinase C3H5.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H5.11 PE=3 SV=1
8	AFDB:O13863	0.655	0.548	1.651E-35	537	0.300	0.250	O13863.pdb.gz	YDU2_SCHPO Uncharacterized kinase C1B1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1B1.02c PE=1 SV=1
9	AFDB:Q9P7K3	0.673	0.668	4.475E-34	449	0.287	0.285	Q9P7K3.pdb.gz	YJN2_SCHPO Uncharacterized kinase C24B10.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC24B10.02c PE=1 SV=1
10	AFDB:Q9UT98	0.654	0.752	2.768E-32	386	0.269	0.311	Q9UT98.pdb.gz	POS5_SCHPO NADH kinase pos5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pos5 PE=3 SV=2
11	PDB:3afoA	0.639	0.786	4.611E-31	360	0.238	0.294	3afoA.pdb.gz	The structural factor conferring NADH kinase activity on yeast mitochondrial Pos5
12	PDB:2an1B	0.568	0.876	1.749E-25	281	0.175	0.278	2an1B.pdb.gz
13	PDB:1u0rD	0.599	0.866	4.234E-25	301	0.175	0.259	1u0rD.pdb.gz
14	PDB:1u0tB	0.542	0.851	1.726E-22	276	0.173	0.279	1u0tB.pdb.gz
15	PDB:1suwA	0.489	0.843	7.434E-19	249	0.143	0.257	1suwA.pdb.gz	Crystal Structures of an NAD Kinase from Archaeoglobus fulgidus in Complex with ATP, NAD, or NADP
16	PDB:2i2aA	0.500	0.816	3.649E-18	264	0.139	0.235	2i2aA.pdb.gz	NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
17	PDB:7n29B	0.480	0.603	5.417E-14	350	0.141	0.180	7n29B.pdb.gz	Structure of human NADK2 reveals atypical assembly and regulation of NAD kinases from animal mitochondria.
18	PDB:5ejgC	0.395	0.768	4.017E-13	218	0.119	0.243	5ejgC.pdb.gz
19	PDB:2bonA	0.372	0.542	5.936E-8	287	0.078	0.122	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
20	PDB:2qv7A	0.359	0.499	5.910E-7	303	0.103	0.152	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZN26	0.0	795	438	0.892	0.909	A0A8I5ZN26_RAT NAD(+) kinase OS=Rattus norvegicus OX=10116 GN=Nadk PE=1 SV=1
2	A0A8I5ZN64	0.0	699	408	0.789	0.863	A0A8I5ZN64_RAT NAD(+) kinase OS=Rattus norvegicus OX=10116 GN=Nadk PE=1 SV=1
3	A0A8I6AFT7	0.0	813	476	0.906	0.849	A0A8I6AFT7_RAT NAD(+) kinase OS=Rattus norvegicus OX=10116 GN=Nadk PE=1 SV=1
4	A0A8I6AKM0	0.0	637	368	0.724	0.878	A0A8I6AKM0_RAT NAD(+) kinase OS=Rattus norvegicus OX=10116 GN=Nadk PE=1 SV=1
5	F7EXV6	0.0	814	444	0.906	0.910	F7EXV6_RAT NAD(+) kinase OS=Rattus norvegicus OX=10116 GN=Nadk PE=3 SV=1
6	O95544	0.0	934	446	1.000	1.000	NADK_HUMAN NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV=1
7	Q5FVF8	0.0	804	455	0.906	0.888	Q5FVF8_RAT NAD(+) kinase OS=Rattus norvegicus OX=10116 GN=Nadk PE=2 SV=1
8	Q6IDH2	2.64e-144	425	548	0.509	0.414	Q6IDH2_DROME NAD(+) kinase OS=Drosophila melanogaster OX=7227 GN=Nadk1a PE=1 SV=1
9	F4HY34	4.41e-88	290	999	0.334	0.149	F4HY34_ARATH NAD kinase 2 OS=Arabidopsis thaliana OX=3702 GN=NADK2 PE=1 SV=1
10	F4IWD3	1.12e-79	256	479	0.291	0.271	F4IWD3_ARATH NAD kinase 1 OS=Arabidopsis thaliana OX=3702 GN=NADK1 PE=1 SV=2
11	P32622	4.82e-73	239	495	0.262	0.236	YEF1_YEAST ATP-NADH kinase YEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEF1 PE=1 SV=1
12	Q6LA56	6.71e-72	233	393	0.278	0.316	YF4B_SCHPO Uncharacterized kinase C3H5.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H5.11 PE=3 SV=1
13	P21373	6.49e-71	235	530	0.294	0.247	UTR1_YEAST NAD(+) kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR1 PE=1 SV=2
14	O13863	5.72e-64	217	537	0.240	0.199	YDU2_SCHPO Uncharacterized kinase C1B1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1B1.02c PE=1 SV=1
15	Q9P7K3	3.23e-57	197	449	0.285	0.283	YJN2_SCHPO Uncharacterized kinase C24B10.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC24B10.02c PE=1 SV=1
16	Q9UT98	3.01e-52	182	386	0.244	0.282	POS5_SCHPO NADH kinase pos5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pos5 PE=3 SV=2
17	Q06892	1.08e-49	176	414	0.231	0.249	POS5_YEAST NADH kinase POS5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POS5 PE=1 SV=2
18	Q58327	1.86e-31	129	574	0.175	0.136	NPPNK_METJA Bifunctional NADP phosphatase/NAD kinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ0917 PE=1 SV=2
19	P65774	3.50e-27	112	292	0.166	0.253	NADK_SALTY NAD kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=nadK PE=1 SV=1
20	P0A7B3	1.50e-26	110	292	0.166	0.253	NADK_ECOLI NAD kinase OS=Escherichia coli (strain K12) OX=83333 GN=nadK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00781 DAGK_cat	1.9e+02	13.0	Diacylglycerol kinase catalytic domain
2	PF17743 DUF5580	3.1e+02	11.3	Family of unknown function (DUF5580)
3	PF01513 NAD_kinase	6.8e-14	63.8	ATP-NAD kinase N-terminal domain
4	PF20143 NAD_kinase_C	1.1e-34	130.3	ATP-NAD kinase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000002308

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000017255	0.980	Pongo abelii nicotinamide nucleotide transhydrogenase (NNT), nuclear gene encoding mitochondrial protein, mRNA
2	9601.ENSPPYP00000000486	0.969	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
3	9601.ENSPPYP00000015838	0.969	Nicotinamide nucleotide adenylyltransferase 3
4	9601.ENSPPYP00000003421	0.948	Glutamine-dependent NAD(+) synthetase
5	9601.ENSPPYP00000017204	0.935	NAD kinase 2, mitochondrial
6	9601.ENSPPYP00000017521	0.930	Hydrolyzes NAD(P)H to NMNH and AMP (2',5'-ADP), and diadenosine diphosphate to AMP. Has also activity towards NAD(P)(+), ADP-ribose and diadenosine triphosphate. May act to regulate the concentration of peroxisomal nicotinamide nucleotide cofactors required for oxidative metabolism in this organelle.
7	9601.ENSPPYP00000002219	0.926	Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
8	9601.ENSPPYP00000019048	0.925	Ectonucleotide pyrophosphatase/phosphodiesterase 1
9	9601.ENSPPYP00000016333	0.923	CD38 molecule
10	9601.ENSPPYP00000023380	0.908	Glucose-6-phosphate 1-dehydrogenase
11	9601.ENSPPYP00000007685	0.886	Isocitrate dehydrogenase 2 (NADP+), mitochondrial
12	9601.ENSPPYP00000014668	0.884	Pongo abelii isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), mRNA
13	9601.ENSPPYP00000011144	0.873	Purple acid phosphatase
14	9601.ENSPPYP00000023761	0.873	Acid phosphatase 5, tartrate resistant
15	9601.ENSPPYP00000020072	0.844	Lipoamide dehydrogenase is a component of the glycine cleavage system as well as an E3 component of three alpha-ketoacid dehydrogenase complexes (pyruvate-, alpha-ketoglutarate-, and branched- chain amino acid-dehydrogenase complex). The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion. A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl-CoA to histone succinyltransferase KAT2A. In monomeric form may have additional mo [...]
16	9601.ENSPPYP00000002839	0.802	ATPase family AAA domain-containing protein 1
17	9601.ENSPPYP00000020346	0.801	Thiamin pyrophosphokinase 1
18	9601.ENSPPYP00000011012	0.793	In the cytoplasm, catalyzes the conversion of glucose-6- phosphate to fructose-6-phosphate, the second step in glycolysis, and the reverse reaction during gluconeogenesis (By similarity). Besides it's role as a glycolytic enzyme, also acts as a secreted cytokine: acts as an angiogenic factor (AMF) that stimulates endothelial cell motility. Acts as a neurotrophic factor, neuroleukin, for spinal and sensory neurons. It is secreted by lectin-stimulated T-cells and induces immunoglobulin secretion (By similarity).
19	9601.ENSPPYP00000009825	0.719	Uncharacterized protein
20	9601.ENSPPYP00000010537	0.719	Sirtuin 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.995	binding
GO:0003951	0.995	NAD+ kinase activity
GO:0005515	0.994	protein binding
GO:0051287	0.341	NAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0065007	0.986	biological regulation
GO:1901564	0.986	organonitrogen compound metabolic process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0048522	0.944	positive regulation of cellular process
GO:0065008	0.940	regulation of biological quality
GO:0010817	0.934	regulation of hormone levels
GO:0051223	0.931	regulation of protein transport
GO:0023051	0.925	regulation of signaling
GO:0010646	0.925	regulation of cell communication
GO:0032024	0.918	positive regulation of insulin secretion
GO:0035774	0.914	positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0044281	0.899	small molecule metabolic process
GO:0034641	0.897	cellular nitrogen compound metabolic process
GO:1901360	0.896	organic cyclic compound metabolic process
GO:0046483	0.896	heterocycle metabolic process
GO:0006796	0.891	phosphate-containing compound metabolic process
GO:0006139	0.890	nucleobase-containing compound metabolic process
GO:0009117	0.789	nucleotide metabolic process
GO:0009058	0.776	biosynthetic process
GO:0044249	0.722	cellular biosynthetic process
GO:0044271	0.707	cellular nitrogen compound biosynthetic process
GO:1901566	0.705	organonitrogen compound biosynthetic process
GO:0072521	0.684	purine-containing compound metabolic process
GO:0034654	0.674	nucleobase-containing compound biosynthetic process
GO:0006163	0.664	purine nucleotide metabolic process
GO:0006164	0.648	purine nucleotide biosynthetic process
GO:0019359	0.630	nicotinamide nucleotide biosynthetic process
GO:0006739	0.620	NADP metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.992	cytosol
GO:0016020	0.478	membrane
GO:0043231	0.338	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18629	0.995	ATP + NAD(+) = ADP + H(+) + NADP(+)
EC:2.7.1.23	0.995	NAD(+) kinase.

[back to server]