StarFunc result for job id O95567

User Input

>input (290 residues)
MHPINVRRDPSIPIYGLRQSILLNTRLQDCYVDSPALTNIWMARTCAKQNINAPAPATTS
SWEVVRNPLIASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQAR
KRNFISSKSKQPAGHRRPAGGIRESKESSKEKKLTVRQDLEDRYAEHVAATQALPQDSGT
AAWKGRVLLPETQKRQQLSEDTLTIHGLPTEGYQALYHAVVEPMLWNPSGTPKRYSLELG
KAIKQKLWEALCSQGAISEGAQRDRFPGRKQPGVHEEPVLKKWPKLKSKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8RQC2	0.092	0.049	1.127E-2	670	0.141	0.061	A0A2R8RQC2.pdb.gz
2	AFDB:E9PEB5	0.104	0.054	3.756E-2	655	0.128	0.056	E9PEB5.pdb.gz	E9PEB5_HUMAN Far upstream element binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=1
3	AFDB:Q38AT6	0.117	0.073	5.493E-2	508	0.166	0.094	Q38AT6.pdb.gz	Q38AT6_TRYB2 PDZ domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0060 PE=4 SV=1
4	AFDB:G5E8Z2	0.084	0.051	1.035E-1	850	0.152	0.052	G5E8Z2.pdb.gz	TAF4B_MOUSE Transcription initiation factor TFIID subunit 4B OS=Mus musculus OX=10090 GN=Taf4b PE=1 SV=2
5	AFDB:Q9LSI1	0.102	0.105	1.175E-1	279	0.062	0.065	Q9LSI1.pdb.gz	Q9LSI1_ARATH NAC (No Apical Meristem) domain transcriptional regulator superfamily protein OS=Arabidopsis thaliana OX=3702 GN=NAC1L PE=4 SV=1
6	AFDB:C0SUU6	0.086	0.074	1.252E-1	352	0.128	0.105	C0SUU6.pdb.gz	STKLA_ARATH Probable transcription factor At1g11510 OS=Arabidopsis thaliana OX=3702 GN=At1g11510 PE=1 SV=1
7	AFDB:E9RD40	0.097	0.046	1.514E-1	797	0.107	0.039	E9RD40.pdb.gz	ABAA_ASPFU Conidiophore development regulator abaA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=abaA PE=2 SV=1
8	AFDB:Q9LP46	0.104	0.037	1.950E-1	1020	0.138	0.039	Q9LP46.pdb.gz	SCAR3_ARATH Protein SCAR3 OS=Arabidopsis thaliana OX=3702 GN=SCAR3 PE=1 SV=1
9	AFDB:P26798	0.141	0.136	2.214E-1	304	0.110	0.105	P26798.pdb.gz	INO2_YEAST Protein INO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INO2 PE=1 SV=1
10	AFDB:Q94HA7	0.106	0.100	2.214E-1	317	0.145	0.132	Q94HA7.pdb.gz	Q94HA7_ORYSJ Helix-loop-helix DNA-binding domain containing protein, expressed OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os03g55220 PE=1 SV=1
11	PDB:1oqyA	0.113	0.106	4.613E-1	363	0.131	0.105	1oqyA.pdb.gz
12	PDB:2nupC	0.105	0.194	1.193	137	0.031	0.066	2nupC.pdb.gz	The Transport Signal on Sec22 for Packaging into COPII-Coated Vesicles is a Conformational Epitope
13	PDB:7mqaNA	0.083	0.082	1.193	295	0.079	0.078	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:3j6bT	0.108	0.142	1.355	209	0.079	0.110	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
15	PDB:4v6wAD	0.082	0.096	1.537	227	0.048	0.062	4v6wAD.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:7q3eC	0.084	0.064	1.745	392	0.038	0.028	7q3eC.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.
17	PDB:2l3yA	0.114	0.166	1.859	184	0.045	0.071	2l3yA.pdb.gz
18	PDB:5datS3	0.100	0.116	1.859	223	0.028	0.036	5datS3.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
19	PDB:6vq6e	0.123	0.339	1.859	78	0.045	0.167	6vq6e.pdb.gz	Structure of V-ATPase from the mammalian brain.
20	PDB:2kxoA	0.099	0.243	2.111	89	0.034	0.112	2kxoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCE6	8.9	30.4	1279	0.093	0.021	ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens OX=9606 GN=ARHGEF10L PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15578 DUF4662	1.3e-152	518.7	Domain of unknown function (DUF4662)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430432	0.632	Histone deacetylase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.920	nucleic acid binding
GO:0003677	0.387	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.921	regulation of cellular process
GO:0071840	0.805	cellular component organization or biogenesis
GO:0019222	0.793	regulation of metabolic process
GO:0016043	0.777	cellular component organization
GO:0048518	0.760	positive regulation of biological process
GO:0008152	0.735	metabolic process
GO:0060255	0.708	regulation of macromolecule metabolic process
GO:0010468	0.681	regulation of gene expression
GO:0071704	0.674	organic substance metabolic process
GO:0044238	0.606	primary metabolic process
GO:0043170	0.598	macromolecule metabolic process
GO:0009966	0.598	regulation of signal transduction
GO:0006807	0.595	nitrogen compound metabolic process
GO:0048522	0.580	positive regulation of cellular process
GO:0048519	0.345	negative regulation of biological process
GO:0051171	0.344	regulation of nitrogen compound metabolic process
GO:0031323	0.343	regulation of cellular metabolic process
GO:0019538	0.339	protein metabolic process
GO:0048523	0.338	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.998	intracellular organelle lumen
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0032991	0.982	protein-containing complex
GO:0005654	0.971	nucleoplasm
GO:0005739	0.842	mitochondrion
GO:1902494	0.525	catalytic complex
GO:0005759	0.423	mitochondrial matrix
GO:0044391	0.422	ribosomal subunit
GO:0098798	0.404	mitochondrial protein-containing complex
GO:0005829	0.322	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]