StarFunc result for job id O95568

User Input

>input (372 residues)
MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHL
WEHKSMENAAPSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIET
LPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFT
KAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDE
ENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPD
YYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTRILKIIDEGLK
RFIIEITFKFPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95568	1.000	1.000	2.539E-77	372	1.000	1.000	O95568.pdb.gz	MET18_HUMAN Histidine protein methyltransferase 1 homolog OS=Homo sapiens OX=9606 GN=METTL18 PE=1 SV=1
2	PDB:4qpnA	0.449	0.793	8.786E-12	203	0.132	0.241	4qpnA.pdb.gz	Crystal Structure of Human Methyltransferase-Like Protein 21B
3	PDB:4mtlB	0.443	0.715	1.405E-9	219	0.132	0.224	4mtlB.pdb.gz	Human Methyltransferase-Like Protein 21C
4	PDB:4lecA	0.434	0.763	1.057E-8	202	0.129	0.238	4lecA.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
5	PDB:4lg1A	0.434	0.703	1.435E-8	217	0.097	0.166	4lg1A.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21D in Complex with SAM
6	PDB:4by9E	0.346	0.525	4.313E-8	227	0.113	0.185	4by9E.pdb.gz	The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
7	PDB:3c6kD	0.352	0.373	1.296E-7	348	0.097	0.103	3c6kD.pdb.gz	Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
8	PDB:5ginE	0.309	0.469	1.655E-7	227	0.126	0.207	5ginE.pdb.gz	Box C/D guide RNAs recognize a maximum of 10 nt of substrates
9	AFDB:Q22053	0.351	0.368	1.967E-7	352	0.132	0.139	Q22053.pdb.gz	FBRL_CAEEL rRNA 2'-O-methyltransferase fibrillarin OS=Caenorhabditis elegans OX=6239 GN=fib-1 PE=2 SV=1
10	PDB:7mq8SD	0.329	0.488	3.665E-7	237	0.102	0.160	7mq8SD.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:1qzzA	0.313	0.337	3.896E-7	340	0.099	0.109	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
12	PDB:3c0kA	0.379	0.360	5.978E-7	395	0.097	0.091	3c0kA.pdb.gz
13	AFDB:Q7K480	0.363	0.118	3.631E-4	1367	0.185	0.050	Q7K480.pdb.gz	MEPCE_DROME 7SK snRNA methylphosphate capping enzyme bin3 OS=Drosophila melanogaster OX=7227 GN=bin3 PE=1 SV=1
14	AFDB:Q8T0L3	0.180	0.066	1.780E-3	1191	0.116	0.036	Q8T0L3.pdb.gz	Q8T0L3_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=1 SV=1
15	AFDB:O88509	0.285	0.140	1.453E-1	859	0.132	0.057	O88509.pdb.gz	DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus OX=10090 GN=Dnmt3b PE=1 SV=2
16	AFDB:Q4W5Z4	0.276	0.130	1.545E-1	877	0.056	0.024	Q4W5Z4.pdb.gz	DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=Gallus gallus OX=9031 GN=DNMT3A PE=2 SV=1
17	AFDB:Q8BJ34	0.158	0.047	2.229E-1	1730	0.145	0.031	Q8BJ34.pdb.gz	MARF1_MOUSE Meiosis regulator and mRNA stability factor 1 OS=Mus musculus OX=10090 GN=Marf1 PE=1 SV=3
18	AFDB:E7F6H4	0.282	0.082	3.217E-1	1500	0.048	0.012	E7F6H4.pdb.gz
19	AFDB:A8DY93	0.179	0.049	3.420E-1	1878	0.086	0.017	A8DY93.pdb.gz	A8DY93_DROME Slowpoke 2, isoform D OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=2
20	AFDB:P41411	0.154	0.116	3.635E-1	577	0.126	0.081	P41411.pdb.gz	CDC18_SCHPO Cell division control protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc18 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95568	0.0	766	372	1.000	1.000	MET18_HUMAN Histidine protein methyltransferase 1 homolog OS=Homo sapiens OX=9606 GN=METTL18 PE=1 SV=1
2	Q9UTQ8	3.50e-23	100	339	0.218	0.239	HPM1_SCHPO Histidine protein methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1071.05 PE=1 SV=1
3	P40481	1.81e-15	79.3	377	0.218	0.215	HPM1_YEAST Histidine protein methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HPM1 PE=1 SV=1
4	D3YWP0	2.79e-07	53.1	232	0.118	0.190	EFMT3_MOUSE EEF1A lysine methyltransferase 3 OS=Mus musculus OX=10090 GN=Eef1akmt3 PE=3 SV=1
5	Q96AZ1	5.23e-06	49.3	226	0.110	0.181	EFMT3_HUMAN EEF1A lysine methyltransferase 3 OS=Homo sapiens OX=9606 GN=EEF1AKMT3 PE=1 SV=1
6	Q8WXB1	2.11e-04	44.3	218	0.113	0.193	MT21A_HUMAN Protein N-lysine methyltransferase METTL21A OS=Homo sapiens OX=9606 GN=METTL21A PE=1 SV=2
7	A2AA28	2.45e-04	44.7	253	0.102	0.150	MET23_MOUSE Histone-arginine methyltransferase METTL23 OS=Mus musculus OX=10090 GN=Mettl23 PE=1 SV=1
8	O13648	0.002	42.7	543	0.056	0.039	ANM3_SCHPO Ribosomal protein arginine N-methyltransferase rmt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt3 PE=1 SV=3
9	Q5A943	0.003	42.0	339	0.067	0.074	Q5A943_CANAL Protein-arginine omega-N methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HMT1 PE=4 SV=1
10	Q86XA0	0.008	39.3	190	0.097	0.189	MET23_HUMAN Histone-arginine methyltransferase METTL23 OS=Homo sapiens OX=9606 GN=METTL23 PE=1 SV=3
11	C8VIM6	0.020	39.3	542	0.073	0.050	C8VIM6_EMENI Protein methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03096 PE=4 SV=1
12	Q9VGW7	0.030	38.5	376	0.040	0.040	Q9VGW7_DROME Arginine methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Art1 PE=1 SV=1
13	F4JNX3	0.032	38.1	304	0.062	0.076	CMKMT_ARATH Calmodulin-lysine N-methyltransferase OS=Arabidopsis thaliana OX=3702 GN=CaMKMT PE=2 SV=1
14	Q84BQ9	0.049	37.4	254	0.059	0.087	PRMA_THET8 Ribosomal protein L11 methyltransferase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=prmA PE=1 SV=2
15	Q9MAT5	0.074	37.4	383	0.046	0.044	ANM10_ARATH Protein arginine N-methyltransferase PRMT10 OS=Arabidopsis thaliana OX=3702 GN=PRMT10 PE=1 SV=1
16	C8V494	0.075	37.4	345	0.043	0.046	C8V494_EMENI RmtA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10526 PE=4 SV=1
17	Q96G04	0.15	36.2	330	0.110	0.124	EF2KT_HUMAN Protein-lysine N-methyltransferase EEF2KMT OS=Homo sapiens OX=9606 GN=EEF2KMT PE=1 SV=2
18	P38074	0.16	36.2	348	0.056	0.060	HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMT1 PE=1 SV=1
19	P0C5J1	0.23	35.8	330	0.124	0.139	F86B2_HUMAN Putative protein N-methyltransferase FAM86B2 OS=Homo sapiens OX=9606 GN=FAM86B2 PE=1 SV=1
20	Q9U2X0	0.29	35.4	348	0.043	0.046	ANM1_CAEEL Protein arginine N-methyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=prmt-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18865 AbiJ_NTD5	3.6e+02	12.5	AbiJ N-terminal domain 5
2	PF03602 Cons_hypoth95	38	15.4	Conserved hypothetical protein 95
3	PF08242 Methyltransf_12	12	18.1	Methyltransferase domain
4	PF10294 Methyltransf_16	4.9e-08	44.4	Lysine methyltransferase
5	PF13489 Methyltransf_23	0.0046	28.3	Methyltransferase domain
6	PF13649 Methyltransf_25	1.5e+02	14.4	Methyltransferase domain
7	PF13847 Methyltransf_31	0.023	25.9	Methyltransferase domain
8	PF05175 MTS	0.17	23.0	Methyltransferase small domain
9	PF06325 PrmA	0.0046	28.0	Ribosomal protein L11 methyltransferase (PrmA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307975

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415115	0.865	Protein N-lysine methyltransferase METTL21A
2	9606.ENSP00000371345	0.850	Methyltransferase-like protein 22
3	9606.ENSP00000379201	0.842	Protein-lysine methyltransferase METTL21D
4	9606.ENSP00000350353	0.821	Electron transfer flavoprotein beta subunit lysine methyltransferase
5	9606.ENSP00000454380	0.814	Protein FAM173A
6	9606.ENSP00000267273	0.812	Protein-lysine methyltransferase METTL21C
7	9606.ENSP00000357829	0.797	EEF1A lysine methyltransferase 2
8	9606.ENSP00000482599	0.796	Methyltransferase-like protein 23
9	9606.ENSP00000398502	0.794	Protein-lysine N-methyltransferase EEF2KMT
10	9606.ENSP00000346001	0.776	60S ribosomal protein L3
11	9606.ENSP00000422338	0.772	Protein FAM173B
12	9606.ENSP00000372206	0.768	EEF1A lysine methyltransferase 1
13	9606.ENSP00000300209	0.710	EEF1A lysine methyltransferase 3
14	9606.ENSP00000354920	0.701	Methyltransferase-like protein 13
15	9606.ENSP00000221856	0.692	Fibronectin type III and SPRY domain-containing protein 1
16	9606.ENSP00000368881	0.686	DNA/RNA-binding protein KIN17
17	9606.ENSP00000253237	0.660	Glutamate-rich WD repeat-containing protein 1
18	9606.ENSP00000356780	0.624	Coiled-coil domain-containing protein 181
19	9606.ENSP00000286031	0.568	Uncharacterized protein C1orf112
20	9606.ENSP00000207870	0.553	Xylulose kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031072	1.000	heat shock protein binding
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008170	1.000	N-methyltransferase activity
GO:0008276	0.939	protein methyltransferase activity
GO:0016279	0.857	protein-lysine N-methyltransferase activity
GO:0018064	0.711	protein-L-histidine N-tele-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0018022	0.996	peptidyl-lysine methylation
GO:0006448	0.993	regulation of translational elongation
GO:0044087	0.980	regulation of cellular component biogenesis
GO:0019219	0.815	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.560	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0031981	0.999	nuclear lumen
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.993	nucleolus
GO:0005654	0.526	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
RHEA:51736	0.857	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine
RHEA:19369	0.711	L-histidyl-[protein] + S-adenosyl-L-methionine = H(+) + N(tele)-methyl-L-histidyl-[protein] + S-adenosyl-L-homocysteine
EC:2.1.1.85	0.711	protein-histidine N-methyltransferase.

[back to server]