StarFunc result for job id O95571

User Input

>input (254 residues)
MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPR
DAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSI
RFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHE
KIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFA
VPANMRCGVQTPTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9DCM0	0.935	0.935	5.247E-55	254	0.902	0.902	Q9DCM0.pdb.gz	ETHE1_MOUSE Persulfide dioxygenase ETHE1, mitochondrial OS=Mus musculus OX=10090 GN=Ethe1 PE=1 SV=2
2	AFDB:M0QXB5	0.904	0.883	3.392E-54	260	0.941	0.919	M0QXB5.pdb.gz	M0QXB5_HUMAN ETHE1 persulfide dioxygenase OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=1
3	PDB:4chlB	0.925	0.991	1.365E-53	237	0.921	0.987	4chlB.pdb.gz	Crystal structure of human persulfide dioxygenase: structural basis of ethylmalonic encephalopathy.
4	AFDB:Q9C8L4	0.906	0.785	9.065E-40	294	0.583	0.503	Q9C8L4.pdb.gz	ETHE1_ARATH Persulfide dioxygenase ETHE1 homolog, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLY3 PE=1 SV=3
5	AFDB:P75849	0.697	0.819	2.124E-17	215	0.217	0.256	P75849.pdb.gz	GLO22_ECOLI Hydroxyacylglutathione hydrolase GloC OS=Escherichia coli (strain K12) OX=83333 GN=gloC PE=1 SV=1
6	AFDB:Q727T9	0.664	0.802	1.139E-16	208	0.252	0.308	Q727T9.pdb.gz	Q727T9_DESVH Metallo-beta-lactamase family protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2765 PE=1 SV=1
7	AFDB:A0A024R415	0.688	0.465	3.083E-16	385	0.264	0.174	A0A024R415.pdb.gz
8	AFDB:Q5ZI23	0.729	0.605	3.491E-16	310	0.256	0.210	Q5ZI23.pdb.gz	GLO2_CHICK Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus OX=9031 GN=HAGH PE=2 SV=1
9	AFDB:C0H490	0.688	0.665	1.554E-15	263	0.228	0.221	C0H490.pdb.gz	C0H490_PLAF7 Cytosolic glyoxalase II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0406400 PE=3 SV=1
10	AFDB:Q9SID3	0.704	0.561	1.654E-15	324	0.240	0.188	Q9SID3.pdb.gz	GLO2N_ARATH Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g31350 PE=1 SV=1
11	AFDB:O94250	0.659	0.654	2.257E-15	256	0.248	0.246	O94250.pdb.gz	GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC13B11.03c PE=3 SV=1
12	PDB:6rz0A	0.661	0.669	1.238E-13	251	0.201	0.203	6rz0A.pdb.gz	Crystal structure of Escherichia coli Glyoxalase II
13	PDB:4ad9A	0.594	0.531	1.399E-10	288	0.240	0.212	4ad9A.pdb.gz	Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
14	PDB:4uwpB	0.536	0.584	2.951E-10	230	0.177	0.196	4uwpB.pdb.gz	Structural and Biochemical Characterization of Vim-26 Show that Leu224 Has Implications for the Substrate Specificity of Vim Metallo-Beta-Lactamases.
15	PDB:2q0jA	0.529	0.442	9.621E-10	310	0.217	0.177	2q0jA.pdb.gz	Structure elucidation and preliminary assessment of hydrolase activity of PqsE, the Pseudomonas quinolone signal (PQS) response protein.
16	PDB:6jkaC	0.586	0.642	1.313E-9	228	0.181	0.202	6jkaC.pdb.gz	Identification of the Inhibitory Compounds for Metallo-beta-lactamases and Structural Analysis of the Binding Modes.
17	PDB:2m5cA	0.546	0.603	4.282E-9	227	0.134	0.150	2m5cA.pdb.gz	Solution structures of the Bacillus cereus metallo-beta-lactamase BcII and its complex with the broad spectrum inhibitor R-thiomandelic acid.
18	PDB:3adrA	0.533	0.524	4.282E-9	259	0.173	0.170	3adrA.pdb.gz	The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; ST1585 from Sulfolobus tokodaii
19	PDB:5evdA	0.506	0.484	5.160E-9	267	0.165	0.157	5evdA.pdb.gz	Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
20	PDB:1m2xA	0.512	0.579	2.028E-8	219	0.098	0.114	1m2xA.pdb.gz	The 1.5 A structure of Chryseobacterium meningosepticum Zn-beta-lactamase in complex with the inhibitor, D-captopril

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5B3	0.0	522	254	1.000	1.000	A0A0S2Z5B3_HUMAN Ethylmalonic encephalopathy 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ETHE1 PE=2 SV=1
2	O95571	0.0	522	254	1.000	1.000	ETHE1_HUMAN Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=2
3	M0QXB5	1.01e-176	488	260	0.933	0.912	M0QXB5_HUMAN ETHE1 persulfide dioxygenase OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=1
4	Q9DCM0	3.10e-173	479	254	0.902	0.902	ETHE1_MOUSE Persulfide dioxygenase ETHE1, mitochondrial OS=Mus musculus OX=10090 GN=Ethe1 PE=1 SV=2
5	Q9C8L4	8.37e-98	289	294	0.563	0.486	ETHE1_ARATH Persulfide dioxygenase ETHE1 homolog, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLY3 PE=1 SV=3
6	Q727T9	1.53e-18	83.2	208	0.256	0.312	Q727T9_DESVH Metallo-beta-lactamase family protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2765 PE=1 SV=1
7	C0H490	1.27e-16	79.0	263	0.260	0.251	C0H490_PLAF7 Cytosolic glyoxalase II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0406400 PE=3 SV=1
8	O94250	6.49e-16	77.0	256	0.220	0.219	GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC13B11.03c PE=3 SV=1
9	Q99KB8	1.04e-15	77.0	309	0.232	0.191	GLO2_MOUSE Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus OX=10090 GN=Hagh PE=1 SV=2
10	P75849	2.88e-15	74.3	215	0.228	0.270	GLO22_ECOLI Hydroxyacylglutathione hydrolase GloC OS=Escherichia coli (strain K12) OX=83333 GN=gloC PE=1 SV=1
11	Q8N490	2.34e-14	73.9	385	0.260	0.171	PNKD_HUMAN Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD PE=1 SV=2
12	O35952	2.84e-14	73.2	309	0.220	0.181	GLO2_RAT Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hagh PE=1 SV=2
13	O24496	3.82e-14	72.0	258	0.209	0.205	GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=GLX2-2 PE=1 SV=2
14	Q5ZI23	7.38e-14	72.0	310	0.193	0.158	GLO2_CHICK Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus OX=9031 GN=HAGH PE=2 SV=1
15	Q69ZP3	1.43e-13	71.6	385	0.264	0.174	PNKD_MOUSE Probable hydrolase PNKD OS=Mus musculus OX=10090 GN=Pnkd PE=1 SV=2
16	Q16775	1.73e-13	70.9	308	0.228	0.188	GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HAGH PE=1 SV=2
17	Q9SID3	2.49e-13	70.5	324	0.209	0.164	GLO2N_ARATH Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g31350 PE=1 SV=1
18	Q6PII5	5.26e-13	69.3	290	0.217	0.190	HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens OX=9606 GN=HAGHL PE=1 SV=1
19	Q9UT36	7.19e-13	68.6	256	0.177	0.176	GLO21_SCHPO Probable hydroxyacylglutathione hydrolase C824.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC824.07 PE=3 SV=1
20	O24495	2.37e-12	67.8	331	0.236	0.181	GLO2M_ARATH Hydroxyacylglutathione hydrolase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLX2-1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00753 Lactamase_B	2.7e-14	65.2	Metallo-beta-lactamase superfamily
2	PF12706 Lactamase_B_2	14	16.7	Beta-lactamase superfamily domain
3	PF15841 TMEM239	4.5e+02	12.1	Transmembrane protein 239 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292147

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260324	0.988	Sulfide:quinone oxidoreductase, mitochondrial
2	9606.ENSP00000377668	0.988	Sulfite oxidase, mitochondrial
3	9606.ENSP00000385828	0.973	Thiosulfate sulfurtransferase
4	9606.ENSP00000380402	0.969	3-mercaptopyruvate sulfurtransferase
5	9606.ENSP00000292140	0.851	Pleckstrin homology like domain family B member 3
6	9606.ENSP00000469029	0.758	Zinc finger protein 574
7	9606.ENSP00000301204	0.748	Transmembrane protein 145
8	9606.ENSP00000260665	0.738	Leucine-rich PPR motif-containing protein, mitochondrial
9	9606.ENSP00000361042	0.730	Surfeit locus protein 1
10	9606.ENSP00000479240	0.718	Phospholipase A2 inhibitor and LY6/PLAUR domain containing
11	9606.ENSP00000233627	0.717	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
12	9606.ENSP00000244333	0.716	Ly6/PLAUR domain-containing protein 3
13	9606.ENSP00000315870	0.716	Zinc finger protein 575
14	9606.ENSP00000356967	0.703	Mitochondrial import receptor subunit TOM40B
15	9606.ENSP00000384273	0.702	Transcription factor p65
16	9606.ENSP00000433757	0.701	Tetratricopeptide repeat domain containing
17	9606.ENSP00000444935	0.690	Platelet-activating factor acetylhydrolase IB subunit gamma
18	9606.ENSP00000410339	0.667	Mitochondrial import receptor subunit TOM40 homolog
19	9606.ENSP00000306678	0.665	Ankyrin repeat and kinase domain containing 1
20	9606.ENSP00000357873	0.662	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016702	1.000	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0005506	0.995	iron ion binding
GO:0042802	0.994	identical protein binding
GO:0016788	0.965	hydrolase activity, acting on ester bonds
GO:0050313	0.614	sulfur dioxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.999	metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.988	organic substance metabolic process
GO:0006790	0.917	sulfur compound metabolic process
GO:0006749	0.861	glutathione metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005654	0.999	nucleoplasm
GO:0005759	0.725	mitochondrial matrix
GO:0016020	0.435	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.13.11.-	1.000	With incorporation of two atoms of oxygen.
EC:3.1.-.-	0.965	Acting on ester bonds.
RHEA:12981	0.614	H2O + O2 + S-sulfanylglutathione = glutathione + 2 H(+) + sulfite
EC:1.13.11.18	0.614	persulfide dioxygenase.

[back to server]