StarFunc result for job id O95600

User Input

>input (359 residues)
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENP
ALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTL
VVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPV
VVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESG
SSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTG
EKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9X4	0.284	0.284	6.169E-49	359	1.000	1.000	A0A024R9X4.pdb.gz
2	AFDB:Q9VZN4	0.244	0.118	2.483E-13	751	0.312	0.149	Q9VZN4.pdb.gz	DAR1_DROME Dendritic arbor reduction protein 1 OS=Drosophila melanogaster OX=7227 GN=dar1 PE=2 SV=2
3	AFDB:O14901	0.251	0.178	5.484E-12	512	0.315	0.221	O14901.pdb.gz	KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens OX=9606 GN=KLF11 PE=1 SV=2
4	AFDB:Q8K1S5	0.249	0.182	1.710E-11	502	0.301	0.215	Q8K1S5.pdb.gz	KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus OX=10090 GN=Klf11 PE=2 SV=3
5	AFDB:Q923B3	0.229	0.102	1.261E-7	828	0.198	0.086	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
6	AFDB:A0A024RDY6	0.236	0.161	1.524E-7	532	0.203	0.137	A0A024RDY6.pdb.gz
7	AFDB:Q9VEW6	0.225	0.091	1.623E-7	924	0.206	0.080	Q9VEW6.pdb.gz	Q9VEW6_DROME IP01015p OS=Drosophila melanogaster OX=7227 GN=pad PE=2 SV=2
8	AFDB:Q09838	0.228	0.127	1.729E-7	681	0.212	0.112	Q09838.pdb.gz	PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prz1 PE=1 SV=1
9	AFDB:A0MWD2	0.219	0.156	1.841E-7	510	0.256	0.180	A0MWD2.pdb.gz	A0MWD2_TAEGU Early growth response protein OS=Taeniopygia guttata OX=59729 GN=zenk PE=2 SV=1
10	AFDB:A0JC51	0.235	0.163	1.962E-7	530	0.206	0.140	A0JC51.pdb.gz	ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis OX=8355 GN=zic4 PE=2 SV=1
11	PDB:3w5kB	0.103	0.231	9.354E-3	110	0.078	0.255	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5c8dE	0.054	0.066	4.860	280	0.019	0.025	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
13	PDB:2k8pA	0.066	0.106	5.177	189	0.075	0.143	2k8pA.pdb.gz
14	PDB:3jb9B	0.055	0.031	5.514	904	0.050	0.020	3jb9B.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
15	PDB:5fj9N	0.053	0.130	7.562	105	0.025	0.086	5fj9N.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
16	PDB:6r5kO	0.064	0.053	7.562	447	0.047	0.038	6r5kO.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
17	PDB:6htsR	0.061	0.226	8.055	72	0.031	0.153	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
18	PDB:7dvqC	0.060	0.035	8.055	902	0.039	0.016	7dvqC.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:1w0rA	0.043	0.037	8.580	442	0.042	0.034	1w0rA.pdb.gz
20	PDB:5gm6a	0.056	0.121	9.139	123	0.058	0.171	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95600	0.0	741	359	1.000	1.000	KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens OX=9606 GN=KLF8 PE=1 SV=2
2	A0S0R1	4.28e-116	342	343	0.496	0.519	A0S0R1_DANRE Krueppel-like factor 8 OS=Danio rerio OX=7955 GN=si:ch211-208m1.2 PE=2 SV=1
3	Q9Y4X4	1.19e-78	248	402	0.448	0.400	KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens OX=9606 GN=KLF12 PE=1 SV=2
4	O35738	2.38e-75	240	402	0.440	0.393	KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus OX=10090 GN=Klf12 PE=1 SV=2
5	D4A4V3	5.97e-55	185	344	0.217	0.227	D4A4V3_RAT Kruppel like factor 3 OS=Rattus norvegicus OX=10116 GN=Klf3 PE=1 SV=1
6	P57682	6.32e-55	185	345	0.217	0.226	KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens OX=9606 GN=KLF3 PE=1 SV=1
7	Q60980	7.15e-55	185	344	0.217	0.227	KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus OX=10090 GN=Klf3 PE=1 SV=1
8	A2BG67	5.10e-53	180	328	0.201	0.220	A2BG67_DANRE Krueppel-like factor 3 OS=Danio rerio OX=7955 GN=klf12 PE=4 SV=1
9	Q66HP1	8.80e-51	175	363	0.198	0.196	Q66HP1_RAT Klf5 protein OS=Rattus norvegicus OX=10116 GN=Klf5 PE=2 SV=1
10	Q13887	2.57e-50	176	457	0.198	0.155	KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens OX=9606 GN=KLF5 PE=1 SV=2
11	Q5T6X2	2.57e-50	176	457	0.198	0.155	Q5T6X2_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=KLF5 PE=2 SV=1
12	F1LSL7	3.22e-50	176	443	0.198	0.160	F1LSL7_RAT Kruppel-like factor 5 OS=Rattus norvegicus OX=10116 GN=Klf5 PE=4 SV=2
13	Q9W1W2	8.82e-50	172	362	0.245	0.243	Q9W1W2_DROME C2H2-type domain-containing protein OS=Drosophila melanogaster OX=7227 GN=CG9895 PE=4 SV=2
14	E9QG09	1.67e-49	173	429	0.198	0.166	E9QG09_DANRE Krueppel-like factor 5 OS=Danio rerio OX=7955 GN=pibf1 PE=4 SV=1
15	Q9Z0Z7	2.33e-49	173	446	0.195	0.157	KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus OX=10090 GN=Klf5 PE=1 SV=2
16	O75840	8.44e-48	165	302	0.184	0.219	KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens OX=9606 GN=KLF7 PE=1 SV=1
17	O08584	8.56e-48	165	283	0.184	0.233	KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus OX=10090 GN=Klf6 PE=2 SV=3
18	O35819	9.62e-48	165	283	0.184	0.233	KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus OX=10116 GN=Klf6 PE=2 SV=2
19	F1R7F0	1.67e-47	164	283	0.184	0.233	F1R7F0_DANRE Krueppel-like factor 6 OS=Danio rerio OX=7955 GN=cb538 PE=4 SV=1
20	Q99612	1.88e-47	164	283	0.184	0.233	KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens OX=9606 GN=KLF6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	5.1e+02	12.5	FOXP coiled-coil domain
2	PF00096 zf-C2H2	4.3e-11	53.8	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.00052	31.6	C2H2-type zinc finger
4	PF17017 zf-C2H2_aberr	7.2e+02	11.7	Aberrant zinc-finger
5	PF13465 zf-H2C2_2	2.5e-07	42.0	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417303

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311825	0.912	C-terminal-binding protein 2
2	9606.ENSP00000290921	0.778	C-terminal-binding protein 1
3	9606.ENSP00000282111	0.610	Transcription factor 7-like 1
4	9606.ENSP00000356234	0.594	Lysine-specific demethylase 5B
5	9606.ENSP00000384524	0.573	ETS translocation variant 2
6	9606.ENSP00000354206	0.570	Zinc finger protein 219
7	9606.ENSP00000380565	0.561	CD151 antigen
8	9606.ENSP00000264444	0.557	Max dimerization protein 1
9	9606.ENSP00000371875	0.539	Homeobox protein Nkx-3.2
10	9606.ENSP00000326371	0.533	Forkhead box protein C2
11	9606.ENSP00000439689	0.510	Transcriptional-regulating factor 1
12	9606.ENSP00000379658	0.507	Transcription factor ETV6
13	9606.ENSP00000263253	0.502	Histone acetyltransferase p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	0.999	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0048519	0.979	negative regulation of biological process
GO:0006357	0.932	regulation of transcription by RNA polymerase II
GO:0048523	0.898	negative regulation of cellular process
GO:0009892	0.897	negative regulation of metabolic process
GO:0051253	0.850	negative regulation of RNA metabolic process
GO:0045892	0.825	negative regulation of DNA-templated transcription
GO:0000122	0.814	negative regulation of transcription by RNA polymerase II
GO:0009987	0.691	cellular process
GO:0048518	0.447	positive regulation of biological process
GO:0009893	0.431	positive regulation of metabolic process
GO:0048522	0.406	positive regulation of cellular process
GO:0031325	0.378	positive regulation of cellular metabolic process
GO:0051173	0.376	positive regulation of nitrogen compound metabolic process
GO:0010604	0.376	positive regulation of macromolecule metabolic process
GO:0032502	0.356	developmental process
GO:0048856	0.351	anatomical structure development
GO:0045893	0.320	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016235	0.991	aggresome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]