StarFunc result for job id O95613

User Input

>input (1400 residues)
MEVEQEQRRRKVEAGRTKLAHFRQRKTKGDSSHSEKKTAKRKGSAVDASVQEESPVTKED
SALCGGGDICKSTSCDDTPDGAGGAFAAQPEDCDGEKREDLEQLQQKQVNDHPPEQCGMF
TVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPE
QRGMFTVSDHTPEQRGIFTISDHPAEQRGMFTKECEQECELAITDLESGREDEAGLHQSQ
AVHGLELEALRLSLSNMHTAQLELTQANLQKEKETALTELREMLNSRRAQELALLQSRQQ
HELELLREQHAREKEEVVLRCGQEAAELKEKLQSEMEKNAQIVKTLKEDWESEKDLCLEN
LRKELSAKHQSEMEDLQNQFQKELAEQRAELEKIFQDKNQAERALRNLESHHQAAIEKLR
EDLQSEHGRCLEDLEFKFKESEKEKQLELENLQASYEDLKAQSQEEIRRLWSQLDSARTS
RQELSELHEQLLARTSRVEDLEQLKQREKTQHESELEQLRIYFEKKLRDAEKTYQEDLTL
LQQRLQGAREDALLDSVEVGLSCVGLEEKPEKGRKDHVDELEPERHKESLPRFQAELEES
HRHQLEALESPLCIQHEGHVSDRCCVETSALGHEWRLEPSEGHSQELPWVHLQGVQDGDL
EADTERAARVLGLETEHKVQLSLLQTELKEEIELLKIENRNLYGKLQHETRLKDDLEKVK
HNLIEDHQKELNNAKQKTELMKQEFQRKETDWKVMKEELQREAEEKLTLMLLELREKAES
EKQTIINKFELREAEMRQLQDQQAAQILDLERSLTEQQGRLQQLEQDLTSDDALHCSQCG
REPPTAQDGELAALHVKEDCALQLMLARSRFLEERKEITEKFSAEQDAFLQEAQEQHARE
LQLLQERHQQQLLSVTAELEARHQAALGELTASLESKQGALLAARVAELQTKHAADLGAL
ETRHLSSLDSLESCYLSEFQTIREEHRQALELLRADFEEQLWKKDSLHQTILTQELEKLK
RKHEGELQSVRDHLRTEVSTELAGTVAHELQGVHQGEFGSEKKTALHEKEETLRLQSAQA
QPFHQEEKESLSLQLQKKNHQVQQLKDQVLSLSHEIEECRSELEVLQQRRERENREGANL
LSMLKADVNLSHSERGALQDALRRLLGLFGETLRAAVTLRSRIGERVGLCLDDAGAGLAL
STAPALEETWSDVALPELDRTLSECAEMSSVAEISSHMRESFLMSPESVRECEQPIRRVF
QSLSLAVDGLMEMALDSSRQLEEARQIHSRFEKEFSFKNEETAQVVRKHQELLECLKEES
AAKAELALELHKTQGTLEGFKVETADLKEVLAGKEDSEHRLVLELESLRRQLQQAAQEQA
ALREECTRLWSRGEATATDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UP2	0.086	0.088	1.154E-10	1357	0.154	0.158	Q86UP2.pdb.gz	KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1
2	AFDB:Q61595	0.088	0.092	3.657E-9	1327	0.148	0.156	Q61595.pdb.gz	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
3	AFDB:F1P0K1	0.089	0.118	1.740E-7	997	0.138	0.194	F1P0K1.pdb.gz
4	AFDB:A0A0B4K7K9	0.071	0.063	3.427E-7	2238	0.144	0.090	A0A0B4K7K9.pdb.gz	A0A0B4K7K9_DROME Bruchpilot, isoform J OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
5	AFDB:B9EK46	0.080	0.090	6.305E-7	1203	0.166	0.194	B9EK46.pdb.gz	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
6	AFDB:Q57YV4	0.103	0.131	8.848E-7	1028	0.097	0.132	Q57YV4.pdb.gz	Q57YV4_TRYB2 Kinetoplast-associated protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.440 PE=4 SV=1
7	AFDB:Q9UPS8	0.093	0.079	3.206E-6	1710	0.172	0.141	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
8	AFDB:Q811D2	0.091	0.082	5.152E-6	1581	0.128	0.113	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
9	AFDB:Q9VEH0	0.076	0.113	6.756E-6	842	0.085	0.141	Q9VEH0.pdb.gz	Q9VEH0_DROME Aluminum tubes, isoform A OS=Drosophila melanogaster OX=7227 GN=alt PE=1 SV=1
10	AFDB:Q9VKH9	0.076	0.060	1.015E-5	1931	0.150	0.109	Q9VKH9.pdb.gz	Q9VKH9_DROME CENP-ana, isoform A OS=Drosophila melanogaster OX=7227 GN=cana PE=3 SV=2
11	PDB:5svaU	0.037	0.196	1.922	156	0.012	0.109	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
12	PDB:7yzpC	0.040	0.099	2.057	448	0.013	0.040	7yzpC.pdb.gz	Structural mechanism of endonucleolytic processing of blocked DNA ends and hairpins by Mre11-Rad50.
13	PDB:7enal	0.029	0.291	2.520	126	0.014	0.151	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:1wn0C	0.033	0.220	2.697	138	0.011	0.109	1wn0C.pdb.gz
15	PDB:2l3yA	0.030	0.156	4.334	184	0.006	0.043	2l3yA.pdb.gz
16	PDB:4p9uE	0.027	0.092	4.334	272	0.014	0.074	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.
17	PDB:7nacI	0.025	0.058	4.638	533	0.014	0.038	7nacI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
18	PDB:3k2sA	0.041	0.164	4.963	243	0.024	0.136	3k2sA.pdb.gz	Double superhelix model of high density lipoprotein.
19	PDB:3k29A	0.051	0.334	5.311	162	0.021	0.185	3k29A.pdb.gz
20	PDB:7enag	0.050	0.276	5.311	166	0.013	0.108	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95613	0.0	2786	3336	1.000	0.420	PCNT_HUMAN Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4
2	P48725	0.0	661	2898	0.294	0.142	PCNT_MOUSE Pericentrin OS=Mus musculus OX=10090 GN=Pcnt PE=1 SV=2
3	A0A0G2K548	7.53e-05	50.1	3847	0.025	0.009	A0A0G2K548_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
4	A0A8I5ZWI9	7.65e-05	50.1	3787	0.025	0.009	A0A8I5ZWI9_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
5	A0A8I5ZKK3	7.70e-05	50.1	3699	0.025	0.009	A0A8I5ZKK3_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
6	F1LPB4	1.37e-04	49.3	3771	0.054	0.020	F1LPB4_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=2
7	A0A8I6GHX5	1.47e-04	49.3	3816	0.054	0.020	A0A8I6GHX5_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
8	A0A8I6AIG6	1.49e-04	49.3	3796	0.054	0.020	A0A8I6AIG6_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
9	Q70FJ1	4.66e-04	47.4	3797	0.022	0.008	AKAP9_MOUSE A-kinase anchor protein 9 OS=Mus musculus OX=10090 GN=Akap9 PE=1 SV=2
10	P11048	0.038	40.8	665	0.053	0.111	LMNA_XENLA Lamin-A OS=Xenopus laevis OX=8355 GN=lmna PE=2 SV=1
11	Q99996	0.061	40.4	3907	0.045	0.016	AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4
12	Q9JK25	0.072	40.0	1320	0.041	0.043	CLIP1_RAT CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2
13	Q9UPV0	0.23	38.5	1460	0.040	0.038	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
14	A0A0A0MRF6	0.37	38.1	3931	0.011	0.004	A0A0A0MRF6_HUMAN A-kinase anchoring protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=2
15	F1Q7X5	0.47	37.7	2708	0.034	0.017	F1Q7X5_DANRE Centromere protein F OS=Danio rerio OX=7955 GN=cenpf PE=1 SV=2
16	A0A286Y8J7	0.49	37.4	2675	0.034	0.018	A0A286Y8J7_DANRE Centromere protein F OS=Danio rerio OX=7955 GN=cenpf PE=1 SV=1
17	Q9VMA7	1.1	36.2	1430	0.039	0.038	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
18	H2L0I2	2.1	35.4	2396	0.021	0.012	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
19	H2L0I4	2.2	35.4	2392	0.021	0.012	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
20	H2L0I3	2.5	35.0	2323	0.021	0.012	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352572

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343818	0.999	CDK5 regulatory subunit-associated protein 2
2	9606.ENSP00000355593	0.995	Disrupted in schizophrenia 1 protein
3	9606.ENSP00000273130	0.991	Cytoplasmic dynein 1 light intermediate chain 1
4	9606.ENSP00000370337	0.972	Centrosomal protein of 152 kDa
5	9606.ENSP00000367766	0.958	X-linked retinitis pigmentosa GTPase regulator
6	9606.ENSP00000370021	0.932	Centlein
7	9606.ENSP00000327077	0.928	Pericentriolar material 1 protein
8	9606.ENSP00000371308	0.927	Centromere protein J
9	9606.ENSP00000245544	0.907	Nuclear pore complex protein Nup85
10	9606.ENSP00000468500	0.907	Glial fibrillary acidic protein
11	9606.ENSP00000217402	0.903	Charged multivesicular body protein 4b
12	9606.ENSP00000270861	0.903	Serine/threonine-protein kinase PLK4
13	9606.ENSP00000324205	0.903	Charged multivesicular body protein 4a
14	9606.ENSP00000251968	0.900	Tumor susceptibility gene 101 protein
15	9606.ENSP00000263780	0.900	Charged multivesicular body protein 2b
16	9606.ENSP00000267202	0.900	Vacuolar protein sorting-associated protein 37B
17	9606.ENSP00000297265	0.900	Charged multivesicular body protein 4c
18	9606.ENSP00000297661	0.900	Ubiquitin-associated protein 1
19	9606.ENSP00000301765	0.900	Vacuolar protein sorting-associated protein 37C
20	9606.ENSP00000317468	0.900	Charged multivesicular body protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0060341	0.968	regulation of cellular localization
GO:0007049	0.964	cell cycle
GO:0000226	0.950	microtubule cytoskeleton organization
GO:0032386	0.934	regulation of intracellular transport
GO:0051223	0.927	regulation of protein transport
GO:0033157	0.921	regulation of intracellular protein transport
GO:0030030	0.898	cell projection organization
GO:0120036	0.893	plasma membrane bounded cell projection organization
GO:0022607	0.861	cellular component assembly
GO:0022402	0.604	cell cycle process
GO:0048522	0.589	positive regulation of cellular process
GO:0070925	0.572	organelle assembly
GO:1903829	0.487	positive regulation of protein localization
GO:0007051	0.481	spindle organization
GO:0051050	0.474	positive regulation of transport
GO:1904951	0.472	positive regulation of establishment of protein localization
GO:0044782	0.466	cilium organization
GO:0090316	0.464	positive regulation of intracellular protein transport
GO:0120031	0.444	plasma membrane bounded cell projection assembly
GO:0000278	0.409	mitotic cell cycle
GO:1903047	0.404	mitotic cell cycle process
GO:0007052	0.302	mitotic spindle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005813	1.000	centrosome
GO:0016020	0.997	membrane
GO:0005814	0.988	centriole
GO:0034451	0.977	centriolar satellite
GO:0043227	0.673	membrane-bounded organelle
GO:0043231	0.520	intracellular membrane-bounded organelle
GO:0005634	0.435	nucleus
GO:0005654	0.330	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]