StarFunc result for job id O95619

User Input

>input (227 residues)
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMS
AYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL
FQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTR
EKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RYE9	0.976	0.976	1.751E-38	227	0.987	0.987	B2RYE9.pdb.gz
2	AFDB:Q9VM63	0.873	0.873	1.490E-25	227	0.590	0.590	Q9VM63.pdb.gz	Q9VM63_DROME Gas41 OS=Drosophila melanogaster OX=7227 GN=Gas41 PE=1 SV=2
3	AFDB:Q21501	0.675	0.721	3.501E-24	211	0.441	0.474	Q21501.pdb.gz	Q21501_CAEEL YEATS domain-containing protein 4 OS=Caenorhabditis elegans OX=6239 GN=gfl-1 PE=1 SV=1
4	AFDB:F8W0J4	0.411	0.533	2.592E-19	173	0.762	1.000	F8W0J4.pdb.gz	F8W0J4_HUMAN YEATS domain containing 4 OS=Homo sapiens OX=9606 GN=YEATS4 PE=1 SV=1
5	AFDB:P53930	0.688	0.691	9.938E-18	226	0.326	0.327	P53930.pdb.gz	AF9_YEAST Protein AF-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAF9 PE=1 SV=1
6	AFDB:Q59LC9	0.688	0.623	1.622E-17	254	0.330	0.295	Q59LC9.pdb.gz	AF9_CANAL Protein AF-9 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YAF9 PE=3 SV=1
7	AFDB:Q10319	0.664	0.691	3.609E-16	217	0.291	0.304	Q10319.pdb.gz	AF9_SCHPO Protein AF-9 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yaf9 PE=3 SV=1
8	AFDB:Q9FH40	0.588	0.504	6.220E-16	268	0.330	0.280	Q9FH40.pdb.gz	TA14B_ARATH Transcription initiation factor TFIID subunit 14b OS=Arabidopsis thaliana OX=3702 GN=TAF14B PE=1 SV=1
9	AFDB:F4IPK2	0.604	0.522	1.630E-14	268	0.326	0.276	F4IPK2.pdb.gz	TAF14_ARATH Transcription initiation factor TFIID subunit 14 OS=Arabidopsis thaliana OX=3702 GN=TAF14 PE=1 SV=1
10	AFDB:Q9VF92	0.545	0.138	4.760E-13	931	0.167	0.041	Q9VF92.pdb.gz	Q9VF92_DROME ENL/AF9-related, isoform A OS=Drosophila melanogaster OX=7227 GN=ear PE=1 SV=1
11	PDB:5svan	0.448	0.503	1.534E-8	200	0.123	0.140	5svan.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
12	PDB:4gwpF	0.159	0.169	3.141E-2	209	0.075	0.081	4gwpF.pdb.gz
13	PDB:6wskA	0.256	0.214	3.699E-2	287	0.066	0.052	6wskA.pdb.gz
14	PDB:8e4cC	0.194	0.275	1.099E-1	142	0.035	0.056	8e4cC.pdb.gz
15	PDB:6dlfA	0.186	0.179	1.366E-1	236	0.048	0.047	6dlfA.pdb.gz
16	PDB:5iicA	0.220	0.120	1.442E-1	472	0.044	0.021	5iicA.pdb.gz	Structural Basis of Egg Coat-Sperm Recognition at Fertilization.
17	PDB:1ogpA	0.175	0.115	1.608E-1	388	0.053	0.031	1ogpA.pdb.gz	The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
18	PDB:1yycA	0.216	0.261	1.698E-1	174	0.075	0.098	1yycA.pdb.gz
19	PDB:7egmH	0.233	0.149	1.698E-1	388	0.084	0.049	7egmH.pdb.gz
20	PDB:3csbA	0.183	0.104	1.999E-1	464	0.035	0.017	3csbA.pdb.gz	A Dominant Conformational Role for Amino Acid Diversity in Minimalist Protein-Protein Interfaces

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95619	7.40e-171	471	227	1.000	1.000	YETS4_HUMAN YEATS domain-containing protein 4 OS=Homo sapiens OX=9606 GN=YEATS4 PE=1 SV=1
2	Q9CR11	3.48e-170	469	227	0.996	0.996	YETS4_MOUSE YEATS domain-containing protein 4 OS=Mus musculus OX=10090 GN=Yeats4 PE=2 SV=1
3	F8W0J4	7.73e-110	314	173	0.736	0.965	F8W0J4_HUMAN YEATS domain containing 4 OS=Homo sapiens OX=9606 GN=YEATS4 PE=1 SV=1
4	A0A8I6GLW6	1.38e-107	308	173	0.722	0.948	A0A8I6GLW6_RAT YEATS domain containing 4 OS=Rattus norvegicus OX=10116 GN=Yeats4 PE=1 SV=1
5	Q9VM63	1.00e-93	275	227	0.590	0.590	Q9VM63_DROME Gas41 OS=Drosophila melanogaster OX=7227 GN=Gas41 PE=1 SV=2
6	Q21501	2.40e-66	205	211	0.445	0.479	Q21501_CAEEL YEATS domain-containing protein 4 OS=Caenorhabditis elegans OX=6239 GN=gfl-1 PE=1 SV=1
7	Q9FH40	5.16e-39	137	268	0.291	0.246	TA14B_ARATH Transcription initiation factor TFIID subunit 14b OS=Arabidopsis thaliana OX=3702 GN=TAF14B PE=1 SV=1
8	P53930	1.90e-38	134	226	0.330	0.332	AF9_YEAST Protein AF-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAF9 PE=1 SV=1
9	F4IPK2	1.17e-31	118	268	0.269	0.228	TAF14_ARATH Transcription initiation factor TFIID subunit 14 OS=Arabidopsis thaliana OX=3702 GN=TAF14 PE=1 SV=1
10	Q10319	1.81e-30	114	217	0.300	0.313	AF9_SCHPO Protein AF-9 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yaf9 PE=3 SV=1
11	Q59LC9	1.44e-27	107	254	0.313	0.280	AF9_CANAL Protein AF-9 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YAF9 PE=3 SV=1
12	Q3TUF7	2.16e-18	85.9	1407	0.220	0.036	YETS2_MOUSE YEATS domain-containing protein 2 OS=Mus musculus OX=10090 GN=Yeats2 PE=1 SV=2
13	Q9ULM3	4.77e-18	84.7	1422	0.216	0.034	YETS2_HUMAN YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2
14	Q8MRJ5	4.78e-13	69.7	512	0.141	0.062	Q8MRJ5_DROME LD02329p (Fragment) OS=Drosophila melanogaster OX=7227 GN=ear PE=2 SV=1
15	Q8IHH1	5.20e-13	69.7	930	0.141	0.034	Q8IHH1_DROME AT01735p OS=Drosophila melanogaster OX=7227 GN=ear PE=2 SV=1
16	Q9VF92	5.20e-13	69.7	931	0.141	0.034	Q9VF92_DROME ENL/AF9-related, isoform A OS=Drosophila melanogaster OX=7227 GN=ear PE=1 SV=1
17	A0A0B4KG69	5.52e-13	69.7	945	0.141	0.034	A0A0B4KG69_DROME ENL/AF9-related, isoform B OS=Drosophila melanogaster OX=7227 GN=ear PE=1 SV=1
18	Q9VLL1	3.35e-12	67.4	969	0.194	0.045	Q9VLL1_DROME D12 OS=Drosophila melanogaster OX=7227 GN=D12 PE=4 SV=1
19	Q9ERL0	4.02e-12	67.0	547	0.154	0.064	Q9ERL0_MOUSE Btk-PH-domain binding protein OS=Mus musculus OX=10090 GN=Mllt1 PE=1 SV=1
20	Q9EPX7	4.33e-12	67.0	547	0.154	0.064	Q9EPX7_MOUSE Leukemia associated gene protein OS=Mus musculus OX=10090 GN=Mllt1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20305 pYEATS	1.2e-06	39.6	prokaryotic YEATS domain
2	PF15361 RIC3	3.5e+02	12.8	Resistance to inhibitors of cholinesterase homologue 3
3	PF11365 SOGA	27	17.2	Protein SOGA
4	PF03366 YEATS	3.2e-30	115.2	YEATS family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004637

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016981	0.996	DNA methyltransferase 1 associated protein 1
2	61853.ENSNLEP00000010671	0.991	Mortality factor 4 like 1
3	61853.ENSNLEP00000007058	0.990	K(lysine) acetyltransferase 5
4	61853.ENSNLEP00000017307	0.990	RuvB-like helicase
5	61853.ENSNLEP00000014063	0.986	MYST/Esa1-associated factor 6
6	61853.ENSNLEP00000022030	0.983	Enhancer of polycomb homolog 1 (Drosophila)
7	61853.ENSNLEP00000005920	0.982	RuvB-like helicase
8	61853.ENSNLEP00000014397	0.982	Inhibitor of growth family, member 3
9	61853.ENSNLEP00000011131	0.981	Enhancer of polycomb homolog 2 (Drosophila)
10	61853.ENSNLEP00000010657	0.980	Bromodomain containing 8
11	61853.ENSNLEP00000012065	0.980	MRG/MORF4L binding protein
12	61853.ENSNLEP00000019381	0.979	Snf2-related CREBBP activator protein
13	61853.ENSNLEP00000010409	0.978	E1A binding protein p400
14	61853.ENSNLEP00000007474	0.966	ARP6 actin-related protein 6 homolog (yeast)
15	61853.ENSNLEP00000012347	0.964	Vacuolar protein sorting 72 homolog (S. cerevisiae)
16	61853.ENSNLEP00000007056	0.962	Actin-like 6A
17	61853.ENSNLEP00000023892	0.958	Uncharacterized protein
18	61853.ENSNLEP00000010052	0.953	Zinc finger, HIT-type containing 1
19	61853.ENSNLEP00000019626	0.953	K(lysine) acetyltransferase 8
20	61853.ENSNLEP00000014469	0.952	Actin-like 6B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036211	0.995	protein modification process
GO:0043543	0.989	protein acylation
GO:0016570	0.989	histone modification
GO:0019222	0.986	regulation of metabolic process
GO:0018193	0.986	peptidyl-amino acid modification
GO:0016573	0.984	histone acetylation
GO:0051173	0.978	positive regulation of nitrogen compound metabolic process
GO:0031325	0.977	positive regulation of cellular metabolic process
GO:0010569	0.971	regulation of double-strand break repair via homologous recombination
GO:2000781	0.971	positive regulation of double-strand break repair
GO:0051726	0.962	regulation of cell cycle
GO:0043967	0.952	histone H4 acetylation
GO:0045911	0.935	positive regulation of DNA recombination
GO:0009987	0.675	cellular process
GO:0010468	0.563	regulation of gene expression
GO:0051252	0.465	regulation of RNA metabolic process
GO:0031326	0.463	regulation of cellular biosynthetic process
GO:0006355	0.448	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.980	protein-containing complex
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0005694	0.823	chromosome
GO:1902494	0.812	catalytic complex
GO:0000785	0.761	chromatin
GO:1990234	0.738	transferase complex
GO:0140535	0.735	intracellular protein-containing complex
GO:0031248	0.668	protein acetyltransferase complex
GO:0000123	0.657	histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]