StarFunc result for job id O95622

User Input

>input (1261 residues)
MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAASGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVEG
GEGSGDGGSSADSGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQS
SLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMGL
ACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSAL
HLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLH
SQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTS
LASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEM
GMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGK
AGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMN
RQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFL
GRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQI
TIVPHSIFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGVF
TITLVFLAAFVNMFTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSP
WPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADL
LVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKL
QATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANF
SEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTY
DKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWG
NTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPL
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3KWA8	0.694	0.949	0.000	919	0.699	0.960	B3KWA8.pdb.gz	B3KWA8_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=1
2	AFDB:E7FEP5	0.805	0.843	0.000	1203	0.652	0.683	E7FEP5.pdb.gz
3	AFDB:E9QDH0	0.794	0.857	0.000	1165	0.637	0.689	E9QDH0.pdb.gz
4	AFDB:O43306	0.814	0.878	0.000	1168	0.620	0.670	O43306.pdb.gz	ADCY6_HUMAN Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2
5	AFDB:P30803	0.850	0.847	0.000	1265	0.922	0.919	P30803.pdb.gz	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
6	AFDB:B7UCF8	0.714	0.735	4.575E-83	1225	0.363	0.374	B7UCF8.pdb.gz	B7UCF8_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:ch211-220f13.4 PE=2 SV=1
7	AFDB:F1LQT1	0.670	0.763	4.602E-73	1100	0.310	0.355	F1LQT1.pdb.gz	F1LQT1_RAT Adenylate cyclase type 7 OS=Rattus norvegicus OX=10116 GN=Adcy7 PE=3 SV=2
8	AFDB:Q9VW60	0.674	0.652	4.602E-73	1307	0.299	0.288	Q9VW60.pdb.gz	ADCY2_DROME Adenylate cyclase type 2 OS=Drosophila melanogaster OX=7227 GN=Ac76E PE=2 SV=3
9	AFDB:Q9NJA2	0.639	0.718	9.361E-56	1112	0.213	0.241	Q9NJA2.pdb.gz	Q9NJA2_DROME Adenylyl cyclase ACXA OS=Drosophila melanogaster OX=7227 GN=ACXA PE=2 SV=1
10	AFDB:Q9NJA1	0.644	0.722	1.055E-54	1114	0.209	0.237	Q9NJA1.pdb.gz	Q9NJA1_DROME Adenylyl cyclase ACXB OS=Drosophila melanogaster OX=7227 GN=ACXB PE=2 SV=1
11	PDB:7yziA	0.174	0.529	4.205E-15	378	0.071	0.238	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
12	PDB:7d9rA	0.178	0.421	1.452E-11	502	0.051	0.127	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
13	PDB:6jt0A	0.162	0.357	3.825E-11	542	0.053	0.124	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
14	PDB:6jt0B	0.177	0.373	3.825E-11	576	0.057	0.125	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:7d9tA	0.141	0.329	3.998E-11	512	0.052	0.129	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
16	PDB:1y11A	0.131	0.402	3.637E-7	364	0.044	0.154	1y11A.pdb.gz
17	PDB:4h54A	0.090	0.348	8.996E-2	274	0.027	0.124	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
18	PDB:6d9mA	0.072	0.241	1.397E-1	326	0.032	0.123	6d9mA.pdb.gz	Structure and mechanism of a Hypr GGDEF enzyme that activates cGAMP signaling to control extracellular metal respiration.
19	PDB:6lqaB	0.064	0.067	2.077E-1	1151	0.073	0.080	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
20	PDB:2xmaE	0.061	0.299	2.171E-1	141	0.010	0.085	2xmaE.pdb.gz	DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A384P5Q5	2623	1261	1.000	1.000	A0A384P5Q5_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 PE=2 SV=1
2	B3KWA8	1831	919	0.699	0.960	B3KWA8_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=1
3	B7UCF8	779	1225	0.364	0.375	B7UCF8_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:ch211-220f13.4 PE=2 SV=1
4	C9JRT8	1717	820	0.650	1.000	C9JRT8_HUMAN Adenylate cyclase 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=2
5	D1MIA3	709	1114	0.331	0.375	D1MIA3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=ADCY1b PE=2 SV=1
6	D2CFN3	1874	1186	0.745	0.792	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
7	D4A3N4	748	1119	0.362	0.408	D4A3N4_RAT Adenylate cyclase type 1 OS=Rattus norvegicus OX=10116 GN=Adcy1 PE=1 SV=3
8	F1LQT1	630	1100	0.320	0.366	F1LQT1_RAT Adenylate cyclase type 7 OS=Rattus norvegicus OX=10116 GN=Adcy7 PE=3 SV=2
9	G0TC75	673	982	0.305	0.392	G0TC75_BOVIN adenylate cyclase OS=Bos taurus OX=9913 GN=ADCY2 PE=2 SV=1
10	O43306	1526	1168	0.626	0.676	ADCY6_HUMAN Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2
11	O60266	674	1144	0.331	0.365	ADCY3_HUMAN Adenylate cyclase type 3 OS=Homo sapiens OX=9606 GN=ADCY3 PE=1 SV=3
12	O88444	750	1118	0.363	0.410	ADCY1_MOUSE Adenylate cyclase type 1 OS=Mus musculus OX=10090 GN=Adcy1 PE=1 SV=2
13	O95622	2623	1261	1.000	1.000	ADCY5_HUMAN Adenylate cyclase type 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=3
14	P19754	762	1134	0.364	0.405	ADCY1_BOVIN Adenylate cyclase type 1 OS=Bos taurus OX=9913 GN=ADCY1 PE=1 SV=1
15	P21932	668	1144	0.328	0.362	ADCY3_RAT Adenylate cyclase type 3 OS=Rattus norvegicus OX=10116 GN=Adcy3 PE=1 SV=1
16	P26769	726	1090	0.335	0.388	ADCY2_RAT Adenylate cyclase type 2 OS=Rattus norvegicus OX=10116 GN=Adcy2 PE=1 SV=1
17	P26770	623	1064	0.315	0.373	ADCY4_RAT Adenylate cyclase type 4 OS=Rattus norvegicus OX=10116 GN=Adcy4 PE=1 SV=1
18	P30803	2229	1265	0.922	0.919	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
19	P40145	758	1251	0.358	0.361	ADCY8_HUMAN Adenylate cyclase type 8 OS=Homo sapiens OX=9606 GN=ADCY8 PE=1 SV=1
20	P40146	760	1248	0.356	0.360	ADCY8_RAT Adenylate cyclase type 8 OS=Rattus norvegicus OX=10116 GN=Adcy8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16214 AC_N	3.9e-245	825.2	Adenylyl cyclase N-terminal extracellular and transmembrane region
2	PF06327 Adcy_cons_dom	1.1e-27	107.9	Adenylate cyclase, conserved domain
3	PF18455 GBR2_CC	3.2e+02	12.6	Gamma-aminobutyric acid type B receptor subunit 2 coiled-coil domain
4	PF00211 Guanylate_cyc	4.2e-119	406.3	Adenylate and Guanylate cyclase catalytic domain
5	PF15220 HILPDA	5.1e+02	12.2	Hypoxia-inducible lipid droplet-associated
6	PF07701 HNOBA	7.8	17.4	Heme NO binding associated
7	PF18396 TBK1_ULD	1.5e+02	13.6	TANK binding kinase 1 ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360141	0.991	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
2	9606.ENSP00000378207	0.991	A-kinase anchor protein 5
3	9606.ENSP00000334051	0.974	Guanine nucleotide-binding protein G(olf) subunit alpha
4	9606.ENSP00000262494	0.972	Guanine nucleotide-binding protein G(o) subunit alpha
5	9606.ENSP00000342952	0.972	Adenylate cyclase type 2
6	9606.ENSP00000343027	0.955	Guanine nucleotide-binding protein G(i) subunit alpha-1
7	9606.ENSP00000341940	0.953	Caveolin-3
8	9606.ENSP00000280979	0.947	A-kinase anchor protein 6
9	9606.ENSP00000294016	0.945	Adenylate cyclase type 9
10	9606.ENSP00000478892	0.943	Guanine nucleotide-binding protein G(z) subunit alpha
11	9606.ENSP00000312999	0.942	Guanine nucleotide-binding protein G(i) subunit alpha-2
12	9606.ENSP00000312126	0.941	Adenylate cyclase type 4
13	9606.ENSP00000378187	0.939	Adenylate cyclase type 7
14	9606.ENSP00000358867	0.933	Guanine nucleotide-binding protein G(k) subunit alpha
15	9606.ENSP00000306124	0.918	Protein kinase C epsilon type
16	9606.ENSP00000286355	0.917	Adenylate cyclase type 8
17	9606.ENSP00000297323	0.916	Adenylate cyclase type 1
18	9606.ENSP00000260600	0.914	Adenylate cyclase type 3
19	9606.ENSP00000368683	0.910	Endothelin-1
20	9606.ENSP00000315011	0.909	Endothelin-1 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004016	1.000	adenylate cyclase activity
GO:0005515	0.995	protein binding
GO:0019899	0.939	enzyme binding
GO:0019901	0.628	protein kinase binding
GO:0005080	0.482	protein kinase C binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0023052	0.996	signaling
GO:0050794	0.996	regulation of cellular process
GO:0007165	0.993	signal transduction
GO:0046058	0.989	cAMP metabolic process
GO:0090407	0.986	organophosphate biosynthetic process
GO:0019438	0.985	aromatic compound biosynthetic process
GO:0044271	0.985	cellular nitrogen compound biosynthetic process
GO:0009190	0.981	cyclic nucleotide biosynthetic process
GO:0007189	0.979	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0009152	0.978	purine ribonucleotide biosynthetic process
GO:0042221	0.953	response to chemical
GO:0010033	0.931	response to organic substance
GO:0032501	0.753	multicellular organismal process
GO:0014070	0.523	response to organic cyclic compound
GO:1901700	0.470	response to oxygen-containing compound
GO:0006171	0.378	cAMP biosynthetic process
GO:0065008	0.365	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.995	organelle
GO:0005622	0.994	intracellular anatomical structure
GO:0043229	0.980	intracellular organelle
GO:0043227	0.945	membrane-bounded organelle
GO:0005737	0.813	cytoplasm
GO:0043231	0.626	intracellular membrane-bounded organelle
GO:0043232	0.597	intracellular non-membrane-bounded organelle
GO:0005856	0.351	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15389	1.000	ATP = 3',5'-cyclic AMP + diphosphate
EC:4.6.1.1	1.000	adenylate cyclase.

[back to server]