StarFunc result for job id O95625

User Input

>input (1053 residues)
MSSEESYRAILRYLTNEREPYAPGTEGNVKRKIRKAAACYVVRGGTLYYQRRQRHRKTFA
ELEVVLQPERRRDLIEAAHLGPGGTHHTRHQTWHYLSKTYWWRGILKQVKDYIKQCSKCQ
EKLDRSRPISDVSEMLEELGLDLESGEESNESEDDLSNFTSSPTTASKPAKKKPVSKHEL
VFVDTKGVVKRSSPKHCQAVLKQLNEQRLSNQFCDVTLLIEGEEYKAHKSVLSANSEYFR
DLFIEKGAVSSHEAVVDLSGFCKASFLPLLEFAYTSVLSFDFCSMADVAILARHLFMSEV
LEICESVHKLMEEKQLTVYKKGEVQTVASTQDLRVQNGGTAPPVASSEGTTTSLPTELGD
CEIVLLVNGELPEAEQNGEVGRQPEPQVSSEAESALSSVGCIADSHPEMESVDLITKNNQ
TELETSNNRENNTVSNIHPKLSKENVISSSPEDSGMGNDISAEDICAEDIPKHRQKVDQP
LKDQENLVASTAKTDFGPDDDTYRSRLRQRSVNEGAYIRLHKGMEKKLQKRKAVPKSAVQ
QVAQKLVQRGKKMKQPKRDAKENTEEASHKCGECGMVFQRRYALIMHKLKHERARDYKCP
LCKKQFQYSASLRAHLIRHTRKDAPSSSSSNSTSNEASGTSSEKGRTKREFICSICGRTL
PKLYSLRIHMLKHTGVKPHACQVCGKTFIYKHGLKLHQSLHQSQKQFQCELCVKSFVTKR
SLQEHMSIHTGESKYLCSVCGKSFHRGSGLSKHFKKHQPKPEVRGYHCTQCEKSFFEARD
LRQHMNKHLGVKPFQCQFCDKCYSWKKDWYSHVKSHSVTEPYRCNICGKEFYEKALFRRH
VKKATHGKKGRAKQNLERVCEKCGRKFTQLREYRRHMNNHEGVKPFECLTCGVAWADARS
LKRHVRTHTGERPYVCPVCSEAYIDARTLRKHMTKFHRDYVPCKIMLEKDTLQFHNQGTQ
VAHAVSILTAGMQEQESSGPQELETVVVTGETMEALEAVAATEEYPSVSTLSDQSIMQVV
NYVLAQQQGQKLSEVAEAIQTVKVEVAHISGGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95625	1.000	1.000	0.000	1053	1.000	1.000	O95625.pdb.gz	ZBT11_HUMAN Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2
2	AFDB:F1RAC1	0.224	0.208	1.803E-101	1146	0.568	0.522	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
3	AFDB:A0A024QZI1	0.085	0.101	2.932E-30	871	0.150	0.181	A0A024QZI1.pdb.gz
4	AFDB:O61360	0.113	0.123	2.932E-30	962	0.146	0.160	O61360.pdb.gz	O61360_DROME CROL ALPHA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
5	AFDB:A0A024R4T5	0.175	0.231	1.897E-28	734	0.159	0.228	A0A024R4T5.pdb.gz
6	AFDB:Q8N1W2	0.123	0.176	3.174E-27	664	0.138	0.218	Q8N1W2.pdb.gz	ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens OX=9606 GN=ZNF710 PE=1 SV=2
7	AFDB:E9PEP7	0.197	0.254	2.298E-25	755	0.135	0.188	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
8	AFDB:A7Y7X5	0.169	0.214	5.393E-24	761	0.119	0.164	A7Y7X5.pdb.gz	ZN711_DANRE Zinc finger protein 711 OS=Danio rerio OX=7955 GN=znf711 PE=1 SV=1
9	AFDB:E9Q8G5	0.148	0.202	3.117E-22	680	0.135	0.209	E9Q8G5.pdb.gz	ZFOI1_MOUSE Zinc finger protein OBI1 OS=Mus musculus OX=10090 GN=ObI1 PE=1 SV=1
10	AFDB:Q9ULJ3	0.100	0.099	9.693E-21	1066	0.166	0.164	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
11	PDB:6wcqC	0.107	0.761	1.809E-6	130	0.032	0.262	6wcqC.pdb.gz
12	PDB:3w5kB	0.056	0.290	6.344E-4	110	0.032	0.309	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:7mk2A	0.097	0.253	3.251E-3	354	0.025	0.073	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
14	PDB:7q5bB	0.088	0.181	2.087E-2	482	0.018	0.039	7q5bB.pdb.gz	Structural basis of Ty3 retrotransposon integration at RNA Polymerase III-transcribed genes.
15	PDB:3ogkA	0.080	0.483	6.089E-2	145	0.013	0.097	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
16	PDB:7f3fA	0.072	0.149	1.500E-1	460	0.013	0.030	7f3fA.pdb.gz
17	PDB:6sgaFS	0.066	0.227	1.988E-1	277	0.021	0.079	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
18	PDB:7sszA	0.076	0.196	2.788E-1	362	0.017	0.050	7sszA.pdb.gz
19	PDB:2p1nD	0.076	0.554	3.909E-1	127	0.011	0.094	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
20	PDB:7sizB	0.073	0.211	5.799E-1	334	0.015	0.048	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RAC1	0.0	1147	1146	0.580	0.533	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
2	O95625	0.0	2196	1053	1.000	1.000	ZBT11_HUMAN Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2
3	Q5TYW1	1.07e-60	228	1059	0.124	0.124	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
4	Q5MCW4	3.84e-60	221	686	0.129	0.198	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
5	Q8NEP9	1.79e-59	218	628	0.121	0.202	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
6	P51814	1.17e-58	219	821	0.124	0.160	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
7	Q96NL3	1.55e-58	214	588	0.120	0.214	ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens OX=9606 GN=ZNF599 PE=1 SV=1
8	P35789	1.57e-58	215	620	0.141	0.239	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
9	Q08ER8	9.80e-58	212	600	0.121	0.212	ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3
10	Q68EA5	9.95e-58	211	555	0.117	0.222	ZNF57_HUMAN Zinc finger protein 57 OS=Homo sapiens OX=9606 GN=ZNF57 PE=1 SV=3
11	Q8TC21	2.16e-57	209	504	0.130	0.272	ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens OX=9606 GN=ZNF596 PE=1 SV=2
12	Q8TBZ8	2.18e-57	210	553	0.119	0.226	ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens OX=9606 GN=ZNF564 PE=1 SV=1
13	Q86WZ6	2.31e-56	212	799	0.119	0.156	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
14	Q9NQZ8	2.52e-56	205	489	0.124	0.268	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
15	Q3KP31	3.21e-56	207	576	0.122	0.222	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
16	Q9UJW8	4.52e-56	209	692	0.116	0.176	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
17	Q9P0L1	4.65e-56	210	754	0.117	0.163	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
18	A0A075BR52	1.05e-55	207	631	0.125	0.209	A0A075BR52_DANRE Draculin-like 3 OS=Danio rerio OX=7955 GN=drl-L3 PE=2 SV=1
19	Q9UK13	1.08e-55	206	617	0.117	0.199	ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens OX=9606 GN=ZNF221 PE=1 SV=4
20	Q8IYB9	1.40e-55	207	648	0.125	0.204	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	1.8e-17	74.9	BTB/POZ domain
2	PF19126 DUF5810	0.11	24.0	Family of unknown function (DUF5810)
3	PF14279 HNH_5	11	17.4	HNH endonuclease
4	PF17921 Integrase_H2C2	1.3e-09	49.3	Integrase zinc binding domain
5	PF00096 zf-C2H2	9.2e-33	122.0	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	2.1e+02	13.1	zinc-finger C2H2-type
7	PF12756 zf-C2H2_2	0.014	27.0	C2H2 type zinc-finger (2 copies)
8	PF13894 zf-C2H2_4	1.2e-30	114.5	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	2.4e-13	61.0	C2H2-type zinc finger
10	PF16293 zf-C2H2_9	2.8e+02	12.8	C2H2 type zinc-finger (1 copy)
11	PF12171 zf-C2H2_jaz	0.0033	28.9	Zinc-finger double-stranded RNA-binding
12	PF05605 zf-Di19	0.00044	31.8	Drought induced 19 protein (Di19), zinc-binding
13	PF13465 zf-H2C2_2	2.9e-40	146.2	Zinc-finger double domain
14	PF12874 zf-met	1.1e+02	14.6	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326200

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359688	0.659	Ribosome production factor 1
2	9606.ENSP00000371994	0.623	Protein NYNRIN
3	9606.ENSP00000361569	0.610	Immediate early response 5 like
4	9606.ENSP00000006526	0.606	WD repeat-containing protein 54
5	9606.ENSP00000363103	0.591	SCAN domain-containing protein 1
6	9606.ENSP00000428223	0.586	Ribosomal protein L26 like 1
7	9606.ENSP00000261745	0.580	N-alpha-acetyltransferase 25, NatB auxiliary subunit
8	9606.ENSP00000481244	0.552	Phospholemman
9	9606.ENSP00000471502	0.550	Leucine-rich repeat-containing protein 4B
10	9606.ENSP00000466379	0.539	ATPase ASNA1
11	9606.ENSP00000371051	0.530	Zinc finger ZZ-type and EF-hand domain containing 1
12	9606.ENSP00000381970	0.526	Gypsy retrotransposon integrase 1
13	9606.ENSP00000251453	0.522	Ribosomal protein S16
14	9606.ENSP00000380872	0.522	piggyBac transposable element derived 4
15	9606.ENSP00000370395	0.517	Small glutamine-rich tetratricopeptide repeat-containing protein beta
16	9606.ENSP00000401749	0.513	Prolyl 4-hydroxylase subunit alpha-3
17	9606.ENSP00000326411	0.512	CWF19-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	0.950	DNA-binding transcription factor activity
GO:0003676	0.940	nucleic acid binding
GO:0043565	0.882	sequence-specific DNA binding
GO:1990837	0.743	sequence-specific double-stranded DNA binding
GO:0000976	0.559	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.984	regulation of biological process
GO:0009987	0.963	cellular process
GO:0050794	0.880	regulation of cellular process
GO:0019222	0.768	regulation of metabolic process
GO:0060255	0.566	regulation of macromolecule metabolic process
GO:0051171	0.549	regulation of nitrogen compound metabolic process
GO:0080090	0.545	regulation of primary metabolic process
GO:0031323	0.543	regulation of cellular metabolic process
GO:0010468	0.467	regulation of gene expression
GO:0019219	0.467	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.443	regulation of RNA metabolic process
GO:0031326	0.428	regulation of cellular biosynthetic process
GO:0010556	0.423	regulation of macromolecule biosynthetic process
GO:2001141	0.389	regulation of RNA biosynthetic process
GO:0006355	0.384	regulation of DNA-templated transcription
GO:0048523	0.378	negative regulation of cellular process
GO:0008152	0.348	metabolic process
GO:0044237	0.334	cellular metabolic process
GO:0071704	0.314	organic substance metabolic process
GO:0006807	0.308	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.566	cytoplasm
GO:0016020	0.328	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]