StarFunc result for job id O95628

User Input

>input (575 residues)
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPY
PEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRL
ADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVV
VDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKL
LQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTP
SPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQT
SSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIE
KELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQ
QHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIP
VAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95628	1.000	1.000	1.218E-93	575	1.000	1.000	O95628.pdb.gz	CNOT4_HUMAN CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3
2	AFDB:M9PB92	0.415	0.232	2.757E-43	1062	0.409	0.221	M9PB92.pdb.gz	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
3	AFDB:Q9GYQ9	0.401	0.294	1.393E-38	796	0.369	0.266	Q9GYQ9.pdb.gz	Q9GYQ9_CAEEL CCR4-NOT transcription complex subunit 4 OS=Caenorhabditis elegans OX=6239 GN=ntl-4 PE=1 SV=2
4	AFDB:Q9M1E4	0.256	0.153	3.858E-24	989	0.254	0.148	Q9M1E4.pdb.gz	Q9M1E4_ARATH RNA binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=F9K21.210 PE=1 SV=1
5	AFDB:A6NDE4	0.141	0.161	5.498E-7	496	0.137	0.159	A6NDE4.pdb.gz	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
6	AFDB:F4J5A7	0.128	0.083	2.881E-6	987	0.139	0.081	F4J5A7.pdb.gz	F4J5A7_ARATH RNA recognition motif (RRM)-containing protein OS=Arabidopsis thaliana OX=3702 GN=At3g23900 PE=1 SV=1
7	PDB:5vsuA	0.127	0.188	4.691E-6	387	0.042	0.062	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
8	AFDB:J3KPK3	0.123	0.151	4.796E-6	459	0.118	0.148	J3KPK3.pdb.gz	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
9	PDB:6y53o	0.123	0.414	5.329E-6	160	0.033	0.119	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
10	PDB:6qx91K	0.123	0.327	6.451E-6	201	0.054	0.154	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
11	PDB:6c0fo	0.122	0.488	2.164E-5	133	0.043	0.188	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
12	PDB:6lurD	0.127	0.311	2.164E-5	213	0.035	0.094	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.
13	PDB:7dvqY	0.118	0.435	2.164E-5	140	0.033	0.136	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:3lqvB	0.114	0.520	3.603E-5	115	0.043	0.217	3lqvB.pdb.gz	Branch Recognition by SF3b14
15	PDB:7dvqI	0.125	0.497	3.840E-5	128	0.030	0.133	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.
16	AFDB:Q1LY77	0.129	0.044	3.926E-5	1844	0.157	0.049	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
17	PDB:1hl6A	0.117	0.496	4.649E-5	119	0.028	0.134	1hl6A.pdb.gz
18	PDB:5gm6V	0.124	0.504	4.649E-5	128	0.031	0.141	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	AFDB:Q9UPN6	0.140	0.071	1.317E-4	1271	0.153	0.069	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
20	AFDB:A0A0S2Z4Z0	0.113	0.098	3.425E-4	669	0.139	0.120	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95628	0.0	1191	575	1.000	1.000	CNOT4_HUMAN CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3
2	M9PB92	7.19e-127	400	1062	0.320	0.173	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
3	Q9GYQ9	9.16e-97	314	796	0.243	0.176	Q9GYQ9_CAEEL CCR4-NOT transcription complex subunit 4 OS=Caenorhabditis elegans OX=6239 GN=ntl-4 PE=1 SV=2
4	P34909	1.06e-65	226	587	0.193	0.189	NOT4_YEAST General negative regulator of transcription subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOT2 PE=1 SV=1
5	Q09818	2.69e-63	218	489	0.207	0.243	YAC4_SCHPO Putative general negative regulator of transcription C16C9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC16C9.04c PE=3 SV=1
6	Q9M1E4	4.09e-61	220	989	0.176	0.102	Q9M1E4_ARATH RNA binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=F9K21.210 PE=1 SV=1
7	A0A1D8PSH4	8.44e-57	202	576	0.190	0.189	A0A1D8PSH4_CANAL CCR4-NOT core ubiquitin-protein ligase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NOT4 PE=4 SV=1
8	F4JXH7	1.01e-56	207	987	0.184	0.107	F4JXH7_ARATH RNA binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g60170 PE=1 SV=1
9	Q94EH8	2.09e-04	45.8	295	0.042	0.081	THO4C_ARATH THO complex subunit 4C OS=Arabidopsis thaliana OX=3702 GN=ALY3 PE=1 SV=1
10	Q9FNI6	0.003	43.1	1029	0.038	0.021	SM3L2_ARATH DNA repair protein RAD5A OS=Arabidopsis thaliana OX=3702 GN=RAD5A PE=1 SV=1
11	O35698	0.005	42.0	380	0.040	0.061	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
12	Q0MW30	0.007	41.6	546	0.033	0.035	NEU1B_MOUSE E3 ubiquitin-protein ligase NEURL1B OS=Mus musculus OX=10090 GN=Neurl1b PE=1 SV=1
13	Q9SRW9	0.011	41.2	1181	0.024	0.012	CSLD5_ARATH Cellulose synthase-like protein D5 OS=Arabidopsis thaliana OX=3702 GN=CSLD5 PE=2 SV=1
14	Q9LFL0	0.012	41.2	1145	0.023	0.011	CSLD2_ARATH Cellulose synthase-like protein D2 OS=Arabidopsis thaliana OX=3702 GN=CSLD2 PE=3 SV=1
15	Q6NQ72	0.015	40.0	288	0.035	0.069	THO4D_ARATH THO complex subunit 4D OS=Arabidopsis thaliana OX=3702 GN=ALY4 PE=1 SV=1
16	Q8BIF2	0.016	40.4	374	0.066	0.102	RFOX3_MOUSE RNA binding protein fox-1 homolog 3 OS=Mus musculus OX=10090 GN=Rbfox3 PE=1 SV=2
17	Q9CAE4	0.019	39.7	261	0.050	0.111	U1131_ARATH U11/U12 small nuclear ribonucleoprotein 31 kDa protein OS=Arabidopsis thaliana OX=3702 GN=SNRNP31 PE=2 SV=1
18	S4R469	0.028	38.9	234	0.050	0.124	S4R469_HUMAN RNA binding fox-1 homolog 2 (Fragment) OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=1
19	A8MQ27	0.029	39.7	555	0.031	0.032	NEU1B_HUMAN E3 ubiquitin-protein ligase NEURL1B OS=Homo sapiens OX=9606 GN=NEURL1B PE=1 SV=1
20	Q9FZ84	0.030	37.7	155	0.061	0.226	RBG6_ARATH Small ribosomal subunit protein mS86 OS=Arabidopsis thaliana OX=3702 GN=RBG6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18912 DZR_2	1.4e+02	13.8	Double zinc ribbon domain
2	PF14605 Nup35_RRM_2	6.6e+02	11.7	Nup53/35/40-type RNA recognition motif
3	PF00076 RRM_1	0.018	26.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF04641 Rtf2	4.6e+02	11.6	Rtf2 RING-finger
5	PF16131 Torus	7.8e+02	12.2	Torus domain
6	PF00097 zf-C3HC4	78	14.6	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	82	14.5	Zinc finger, C3HC4 type (RING finger)
8	PF14608 zf-CCCH_2	88	15.1	RNA-binding, Nab2-type zinc finger
9	PF13639 zf-RING_2	21	16.9	Ring finger domain
10	PF14570 zf-RING_4	6.4e-17	72.4	RING/Ubox like zinc-binding domain
11	PF14634 zf-RING_5	7.9e+02	11.5	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 29073.XP_008705823.1

Rank	PPI partner	STRING score	Description
1	29073.XP_008682506.1	0.996	CCR4-NOT transcription complex subunit 2 isoform X1
2	29073.XP_008688692.1	0.996	CCR4-NOT transcription complex subunit 9
3	29073.XP_008700793.1	0.996	CCR4-NOT transcription complex subunit 1 isoform X1
4	29073.XP_008699836.1	0.995	CCR4-NOT transcription complex subunit 3
5	29073.XP_008692958.1	0.965	Exosome component 10
6	29073.XP_008690684.1	0.964	CCR4-NOT transcription complex subunit 8
7	29073.XP_008691485.1	0.964	CCR4-NOT transcription complex subunit 6-like isoform X1
8	29073.XP_008707744.1	0.964	CCR4-NOT transcription complex subunit 6 isoform X1
9	29073.XP_008709117.1	0.964	CCR4-NOT transcription complex subunit 7
10	29073.XP_008699377.1	0.893	Protein angel homolog 2 isoform X1
11	29073.XP_008683632.1	0.873	Nocturnin
12	29073.XP_008684143.1	0.873	Leucine-rich repeat-containing protein 27 isoform X1
13	29073.XP_008701383.1	0.873	2',5'-phosphodiesterase 12
14	29073.XP_008697970.1	0.871	CCR4-NOT transcription complex subunit 11
15	29073.XP_008688225.1	0.847	DEAD-box helicase 6
16	29073.XP_008689635.1	0.847	Ski2 like RNA helicase 2
17	29073.XP_008708677.1	0.819	CCR4-NOT transcription complex subunit 10
18	29073.XP_008689748.1	0.778	Belongs to the ubiquitin-conjugating enzyme family.
19	29073.XP_008694125.1	0.778	Belongs to the ubiquitin-conjugating enzyme family.
20	29073.XP_008705438.1	0.778	Belongs to the ubiquitin-conjugating enzyme family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0071704	0.980	organic substance metabolic process
GO:0009987	0.979	cellular process
GO:0044238	0.975	primary metabolic process
GO:0006807	0.961	nitrogen compound metabolic process
GO:0043412	0.959	macromolecule modification
GO:0044237	0.958	cellular metabolic process
GO:0043632	0.954	modification-dependent macromolecule catabolic process
GO:0016567	0.952	protein ubiquitination
GO:0051603	0.943	proteolysis involved in protein catabolic process
GO:0045637	0.916	regulation of myeloid cell differentiation
GO:0006511	0.886	ubiquitin-dependent protein catabolic process
GO:0051865	0.841	protein autoubiquitination
GO:0048518	0.406	positive regulation of biological process
GO:0019222	0.372	regulation of metabolic process
GO:0060255	0.364	regulation of macromolecule metabolic process
GO:0051171	0.353	regulation of nitrogen compound metabolic process
GO:0048522	0.353	positive regulation of cellular process
GO:0080090	0.351	regulation of primary metabolic process
GO:0031323	0.343	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.997	protein-containing complex
GO:0030014	0.992	CCR4-NOT complex
GO:0043226	0.937	organelle
GO:0043229	0.918	intracellular organelle
GO:0005634	0.830	nucleus
GO:0070013	0.558	intracellular organelle lumen
GO:0031981	0.550	nuclear lumen
GO:0005654	0.513	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]