StarFunc result for job id O95631

User Input

>input (604 residues)
MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
CRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQD
WVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLS
GRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTT
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASK
GKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSR
DIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK
CKKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B5JPZ7	0.762	0.763	0.000	603	0.856	0.857	A0A0B5JPZ7.pdb.gz
2	AFDB:B3DJ84	0.749	0.751	0.000	602	0.808	0.811	B3DJ84.pdb.gz
3	AFDB:O09118	0.929	0.929	0.000	604	0.992	0.992	O09118.pdb.gz	NET1_MOUSE Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=3
4	AFDB:Q90922	0.831	0.829	0.000	606	0.864	0.861	Q90922.pdb.gz	NET1_CHICK Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=1
5	AFDB:Q90923	0.864	0.896	6.665E-100	581	0.680	0.707	Q90923.pdb.gz	NET3_CHICK Netrin-3 (Fragment) OS=Gallus gallus OX=9031 GN=NTN3 PE=2 SV=1
6	AFDB:P34710	0.763	0.754	8.530E-87	612	0.517	0.510	P34710.pdb.gz	UNC6_CAEEL Netrin unc-6 OS=Caenorhabditis elegans OX=6239 GN=unc-6 PE=1 SV=1
7	AFDB:Q9R1A3	0.740	0.767	9.896E-81	580	0.515	0.536	Q9R1A3.pdb.gz	NET3_MOUSE Netrin-3 OS=Mus musculus OX=10090 GN=Ntn3 PE=2 SV=1
8	AFDB:O00634	0.749	0.777	2.177E-80	580	0.523	0.545	O00634.pdb.gz	NET3_HUMAN Netrin-3 OS=Homo sapiens OX=9606 GN=NTN3 PE=1 SV=1
9	AFDB:A0A0B5JQ66	0.685	0.868	3.248E-79	473	0.558	0.712	A0A0B5JQ66.pdb.gz
10	AFDB:Q24567	0.654	0.546	6.753E-79	726	0.510	0.424	Q24567.pdb.gz	NETA_DROME Netrin-A OS=Drosophila melanogaster OX=7227 GN=NetA PE=2 SV=2
11	PDB:1xpwA	0.180	0.662	8.960E-5	143	0.046	0.196	1xpwA.pdb.gz
12	PDB:1o59A	0.188	0.342	1.187E-4	318	0.036	0.069	1o59A.pdb.gz
13	PDB:4g1eB	0.097	0.087	2.469E-4	709	0.108	0.092	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
14	PDB:8a3tA	0.195	0.488	2.612E-4	219	0.045	0.123	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
15	PDB:1k12A	0.187	0.622	3.662E-4	158	0.041	0.158	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
16	PDB:7qe7L	0.182	0.539	4.335E-4	183	0.036	0.120	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:4bxsV	0.162	0.081	1.414E-3	1262	0.048	0.023	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
18	PDB:7kveB	0.183	0.085	2.484E-3	1374	0.040	0.017	7kveB.pdb.gz
19	PDB:7nycA	0.149	0.061	8.102E-3	1542	0.075	0.029	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:2vmeA	0.180	0.393	8.572E-3	256	0.035	0.082	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QUK5	0.0	1066	602	0.808	0.811	F1QUK5_DANRE Netrin-1 OS=Danio rerio OX=7955 GN=net1 PE=1 SV=1
2	O00634	0.0	617	580	0.497	0.517	NET3_HUMAN Netrin-3 OS=Homo sapiens OX=9606 GN=NTN3 PE=1 SV=1
3	O09118	0.0	1255	604	0.992	0.992	NET1_MOUSE Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=3
4	O42140	0.0	1123	603	0.866	0.867	O42140_DANRE Netrin-1 OS=Danio rerio OX=7955 GN=ntn2 PE=1 SV=1
5	O42203	0.0	1060	602	0.805	0.807	O42203_DANRE Netrin-1 OS=Danio rerio OX=7955 GN=net1 PE=2 SV=1
6	O95631	0.0	1261	604	1.000	1.000	NET1_HUMAN Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2
7	P34710	0.0	646	612	0.520	0.513	UNC6_CAEEL Netrin unc-6 OS=Caenorhabditis elegans OX=6239 GN=unc-6 PE=1 SV=1
8	Q24567	0.0	532	726	0.462	0.384	NETA_DROME Netrin-A OS=Drosophila melanogaster OX=7227 GN=NetA PE=2 SV=2
9	Q90922	0.0	1104	606	0.864	0.861	NET1_CHICK Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=1
10	Q90923	0.0	885	581	0.679	0.706	NET3_CHICK Netrin-3 (Fragment) OS=Gallus gallus OX=9031 GN=NTN3 PE=2 SV=1
11	Q924Z9	0.0	1247	604	0.985	0.985	NET1_RAT Netrin-1 OS=Rattus norvegicus OX=10116 GN=Ntn1 PE=1 SV=1
12	Q9R1A3	0.0	613	580	0.497	0.517	NET3_MOUSE Netrin-3 OS=Mus musculus OX=10090 GN=Ntn3 PE=2 SV=1
13	P11047	3.47e-132	425	1609	0.341	0.128	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
14	F1MD77	1.15e-131	423	1608	0.344	0.129	F1MD77_BOVIN Laminin subunit gamma 1 OS=Bos taurus OX=9913 GN=LAMC1 PE=1 SV=2
15	P02468	7.68e-131	421	1607	0.356	0.134	LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus OX=10090 GN=Lamc1 PE=1 SV=2
16	Q1LVF0	1.60e-130	420	1593	0.349	0.132	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
17	F1MAA7	1.03e-129	418	1607	0.341	0.128	F1MAA7_RAT Laminin subunit gamma 1 OS=Rattus norvegicus OX=10116 GN=Lamc1 PE=1 SV=1
18	F1QPJ1	2.22e-120	392	1643	0.333	0.122	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
19	Q9R0B6	7.46e-118	385	1581	0.333	0.127	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
20	Q18823	1.18e-115	379	1633	0.321	0.119	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00053 Laminin_EGF	6e-24	95.3	Laminin EGF domain
2	PF00055 Laminin_N	5.2e-84	293.0	Laminin N-terminal (Domain VI)
3	PF01759 NTR	3.7e-28	108.8	UNC-6/NTR/C345C module

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000173229

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332737	0.999	Netrin receptor UNC5A
2	9606.ENSP00000334329	0.999	Netrin receptor UNC5B
3	9606.ENSP00000341198	0.999	Neogenin
4	9606.ENSP00000383303	0.999	Down syndrome cell adhesion molecule
5	9606.ENSP00000389140	0.999	Netrin receptor DCC
6	9606.ENSP00000406022	0.999	Netrin receptor UNC5C
7	9606.ENSP00000294485	0.980	Draxin
8	9606.ENSP00000380903	0.969	Roundabout homolog 3
9	9606.ENSP00000385143	0.956	Netrin receptor UNC5D
10	9606.ENSP00000346671	0.955	Tyrosine-protein kinase Fyn
11	9606.ENSP00000264036	0.954	Cell surface glycoprotein MUC18
12	9606.ENSP00000400175	0.953	Transforming protein RhoA
13	9606.ENSP00000304501	0.952	Adenosine receptor A2b
14	9606.ENSP00000339299	0.951	Triple functional domain protein
15	9606.ENSP00000383118	0.949	Cell division control protein 42 homolog
16	9606.ENSP00000341189	0.944	Focal adhesion kinase 1
17	9606.ENSP00000316809	0.943	Phosphatidylinositol transfer protein alpha isoform
18	9606.ENSP00000280333	0.942	Dedicator of cytokinesis protein 1
19	9606.ENSP00000284981	0.941	Amyloid-beta A4 protein
20	9606.ENSP00000296755	0.938	Microtubule-associated protein 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.419	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050793	0.990	regulation of developmental process
GO:0050896	0.988	response to stimulus
GO:0032501	0.987	multicellular organismal process
GO:0008361	0.982	regulation of cell size
GO:0001558	0.981	regulation of cell growth
GO:0048518	0.976	positive regulation of biological process
GO:0007275	0.975	multicellular organism development
GO:0040011	0.968	locomotion
GO:0048522	0.964	positive regulation of cellular process
GO:0048731	0.942	system development
GO:0030516	0.941	regulation of axon extension
GO:0031344	0.933	regulation of cell projection organization
GO:0009653	0.932	anatomical structure morphogenesis
GO:0030154	0.930	cell differentiation
GO:0120039	0.919	plasma membrane bounded cell projection morphogenesis
GO:0022603	0.913	regulation of anatomical structure morphogenesis
GO:0120035	0.909	regulation of plasma membrane bounded cell projection organization
GO:0051960	0.909	regulation of nervous system development
GO:0031346	0.899	positive regulation of cell projection organization
GO:0060284	0.893	regulation of cell development
GO:0048667	0.884	cell morphogenesis involved in neuron differentiation
GO:0050770	0.873	regulation of axonogenesis
GO:0007154	0.866	cell communication
GO:0042221	0.863	response to chemical
GO:0048513	0.863	animal organ development
GO:0023052	0.862	signaling
GO:0061564	0.857	axon development
GO:0045597	0.852	positive regulation of cell differentiation
GO:0051716	0.849	cellular response to stimulus
GO:0040012	0.840	regulation of locomotion
GO:0050772	0.827	positive regulation of axonogenesis
GO:0030307	0.816	positive regulation of cell growth
GO:0007165	0.812	signal transduction
GO:0045773	0.800	positive regulation of axon extension
GO:0048870	0.786	cell motility
GO:2000145	0.743	regulation of cell motility
GO:0048812	0.711	neuron projection morphogenesis
GO:0016477	0.687	cell migration
GO:0007409	0.671	axonogenesis
GO:0040017	0.653	positive regulation of locomotion
GO:0048519	0.648	negative regulation of biological process
GO:0006935	0.628	chemotaxis
GO:0048523	0.617	negative regulation of cellular process
GO:0019222	0.512	regulation of metabolic process
GO:0060255	0.424	regulation of macromolecule metabolic process
GO:0080090	0.423	regulation of primary metabolic process
GO:0051171	0.423	regulation of nitrogen compound metabolic process
GO:0031323	0.423	regulation of cellular metabolic process
GO:0048583	0.392	regulation of response to stimulus
GO:0097485	0.376	neuron projection guidance
GO:0007411	0.371	axon guidance
GO:0007417	0.328	central nervous system development
GO:0060322	0.313	head development
GO:0030334	0.302	regulation of cell migration
GO:0007420	0.302	brain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005576	0.997	extracellular region
GO:0005622	0.960	intracellular anatomical structure
GO:0005886	0.936	plasma membrane
GO:0030312	0.930	external encapsulating structure
GO:0005737	0.915	cytoplasm
GO:0031012	0.873	extracellular matrix
GO:0043226	0.730	organelle
GO:0043227	0.697	membrane-bounded organelle
GO:0043229	0.560	intracellular organelle
GO:0043231	0.486	intracellular membrane-bounded organelle
GO:0062023	0.412	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]