StarFunc result for job id O95644

User Input

>input (943 residues)
MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPT
AHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRI
EITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSR
SCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPST
SPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW
LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSP
PPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGT
ADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLR
NSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK
QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEI
PPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQ
GLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGV
ASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEH
SLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE
DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZE20	0.302	0.337	0.000	827	0.759	0.866	D3ZE20.pdb.gz	D3ZE20_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=4
2	AFDB:O95644	0.999	0.999	0.000	943	1.000	1.000	O95644.pdb.gz	NFAC1_HUMAN Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3
3	AFDB:A0A1D5PNG2	0.295	0.311	2.546E-98	890	0.718	0.761	A0A1D5PNG2.pdb.gz
4	AFDB:F1QUZ9	0.353	0.380	4.359E-77	867	0.550	0.599	F1QUZ9.pdb.gz
5	AFDB:K7ER53	0.199	0.287	1.589E-70	639	0.598	0.883	K7ER53.pdb.gz	K7ER53_HUMAN Nuclear factor of activated T cells 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=1
6	AFDB:A0A0G2JTY4	0.244	0.217	2.676E-55	1076	0.429	0.376	A0A0G2JTY4.pdb.gz	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
7	AFDB:B5B2S1	0.289	0.255	1.817E-54	1075	0.429	0.377	B5B2S1.pdb.gz	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
8	AFDB:Q54NE5	0.084	0.055	3.845E-8	1918	0.104	0.051	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
9	AFDB:Q15735	0.100	0.094	1.124E-4	1006	0.171	0.160	Q15735.pdb.gz	PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5J PE=1 SV=3
10	PDB:5c6wJ	0.081	0.251	2.551E-4	238	0.028	0.109	5c6wJ.pdb.gz
11	PDB:7tvzE	0.121	0.154	5.975E-4	665	0.041	0.059	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
12	PDB:3fcsA	0.118	0.121	7.009E-4	913	0.037	0.038	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
13	PDB:6vxkB	0.073	0.091	7.796E-4	747	0.029	0.036	6vxkB.pdb.gz
14	AFDB:Q99N50	0.072	0.072	8.947E-4	950	0.102	0.101	Q99N50.pdb.gz	SYTL2_MOUSE Synaptotagmin-like protein 2 OS=Mus musculus OX=10090 GN=Sytl2 PE=1 SV=2
15	PDB:1l9mB	0.123	0.156	1.193E-3	681	0.040	0.056	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
16	PDB:5mhlA	0.090	0.112	1.193E-3	692	0.020	0.027	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.
17	PDB:3o3uN	0.081	0.115	2.142E-3	580	0.037	0.060	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
18	PDB:7q1yA	0.102	0.079	2.142E-3	1374	0.034	0.023	7q1yA.pdb.gz
19	PDB:4nehA	0.094	0.085	3.109E-3	1084	0.035	0.030	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
20	PDB:7vonA	0.096	0.072	4.278E-3	1399	0.038	0.026	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JXL2	0.0	1459	925	0.805	0.821	A0A0G2JXL2_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=2
2	A0A1D5PI24	0.0	1121	732	0.587	0.757	A0A1D5PI24_CHICK Nuclear factor of activated T cells 1 OS=Gallus gallus OX=9031 GN=NFATC1 PE=4 SV=2
3	D3ZE20	0.0	1523	939	0.840	0.843	D3ZE20_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=4
4	K7ER53	0.0	1131	639	0.593	0.875	K7ER53_HUMAN Nuclear factor of activated T cells 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=1
5	O88942	0.0	1231	717	0.657	0.865	NFAC1_MOUSE Nuclear factor of activated T-cells, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Nfatc1 PE=1 SV=1
6	O95644	0.0	1903	943	1.000	1.000	NFAC1_HUMAN Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3
7	Q19AW4	0.0	884	867	0.561	0.610	Q19AW4_DANRE Nuclear factor of activated T-cells calcineurin-dependent 1 OS=Danio rerio OX=7955 GN=si:ch211-198c22.2 PE=2 SV=1
8	Q60591	0.0	555	927	0.415	0.422	NFAC2_MOUSE Nuclear factor of activated T-cells, cytoplasmic 2 OS=Mus musculus OX=10090 GN=Nfatc2 PE=1 SV=3
9	W5U9R6	0.0	842	879	0.546	0.586	W5U9R6_ICTPU Nuclear factor of activated T-cells, cytoplasmic 1 OS=Ictalurus punctatus OX=7998 GN=NFATC1 PE=2 SV=1
10	Q13469	2.34e-178	543	925	0.428	0.437	NFAC2_HUMAN Nuclear factor of activated T-cells, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=NFATC2 PE=1 SV=2
11	D4A0I8	1.94e-177	541	931	0.449	0.454	D4A0I8_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
12	A0A8I5ZLE7	4.14e-172	526	927	0.445	0.453	A0A8I5ZLE7_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
13	A0A8I6A3G2	4.32e-171	524	927	0.441	0.449	A0A8I6A3G2_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
14	I3L3K7	6.05e-169	522	1047	0.293	0.264	I3L3K7_HUMAN Nuclear factor of activated T cells 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
15	H3BRS1	1.80e-168	521	1060	0.293	0.260	H3BRS1_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
16	B5B2S0	1.96e-168	521	1068	0.293	0.258	B5B2S0_HUMAN Nuclear factor of activated T-cells c3 isoform IB-Xa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
17	A0A8I6AB55	2.14e-168	521	1052	0.344	0.308	A0A8I6AB55_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
18	B5B2S1	2.20e-168	521	1075	0.293	0.257	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
19	Q12968	2.20e-168	521	1075	0.293	0.257	NFAC3_HUMAN Nuclear factor of activated T-cells, cytoplasmic 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
20	H3BR83	3.54e-168	520	1053	0.293	0.262	H3BR83_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16179 RHD_dimer	9.5e-21	85.1	Rel homology dimerisation domain
2	PF00554 RHD_DNA_bind	1.8e-21	88.4	Rel homology DNA-binding domain
3	PF01833 TIG	0.025	26.0	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389377

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378323	0.998	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
2	9606.ENSP00000234310	0.994	Calcineurin subunit B type 1
3	9606.ENSP00000306245	0.993	Proto-oncogene c-Fos
4	9606.ENSP00000360266	0.988	Transcription factor AP-1
5	9606.ENSP00000370343	0.981	Interferon regulatory factor 4
6	9606.ENSP00000334458	0.980	Transcription factor GATA-4
7	9606.ENSP00000239938	0.975	Early growth response protein 1
8	9606.ENSP00000443827	0.971	Transcription factor Sp7
9	9606.ENSP00000365380	0.970	Forkhead box protein P3
10	9606.ENSP00000398698	0.961	Tumor necrosis factor
11	9606.ENSP00000380878	0.958	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
12	9606.ENSP00000227163	0.954	Transcription factor PU.1
13	9606.ENSP00000264657	0.953	Signal transducer and activator of transcription 3
14	9606.ENSP00000423602	0.953	Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
15	9606.ENSP00000326371	0.952	Forkhead box protein C2
16	9606.ENSP00000287820	0.951	Peroxisome proliferator-activated receptor gamma
17	9606.ENSP00000231449	0.950	Interleukin-4
18	9606.ENSP00000262367	0.949	CREB-binding protein
19	9606.ENSP00000378974	0.947	Mitogen-activated protein kinase 8
20	9606.ENSP00000229795	0.946	Mitogen-activated protein kinase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0008134	0.999	transcription factor binding
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0000977	0.956	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0033218	0.930	amide binding
GO:0005527	0.927	macrolide binding
GO:0005528	0.923	FK506 binding
GO:0000981	0.917	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.669	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.657	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001217	0.654	DNA-binding transcription repressor activity
GO:0019899	0.647	enzyme binding
GO:0001221	0.631	transcription coregulator binding
GO:0001216	0.617	DNA-binding transcription activator activity
GO:0001228	0.597	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001227	0.400	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0009987	0.992	cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0010604	0.977	positive regulation of macromolecule metabolic process
GO:0031325	0.977	positive regulation of cellular metabolic process
GO:0010468	0.975	regulation of gene expression
GO:0010556	0.975	regulation of macromolecule biosynthetic process
GO:0051173	0.975	positive regulation of nitrogen compound metabolic process
GO:0031326	0.975	regulation of cellular biosynthetic process
GO:0051252	0.975	regulation of RNA metabolic process
GO:0006355	0.973	regulation of DNA-templated transcription
GO:0009891	0.958	positive regulation of biosynthetic process
GO:0048519	0.953	negative regulation of biological process
GO:0045935	0.953	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.952	positive regulation of cellular biosynthetic process
GO:0007154	0.948	cell communication
GO:0023052	0.946	signaling
GO:0010557	0.944	positive regulation of macromolecule biosynthetic process
GO:0048523	0.939	negative regulation of cellular process
GO:0045893	0.927	positive regulation of DNA-templated transcription
GO:0007165	0.925	signal transduction
GO:0045944	0.712	positive regulation of transcription by RNA polymerase II
GO:0042221	0.702	response to chemical
GO:0032502	0.691	developmental process
GO:0048856	0.666	anatomical structure development
GO:0010033	0.666	response to organic substance
GO:0050793	0.627	regulation of developmental process
GO:0032501	0.574	multicellular organismal process
GO:0035556	0.539	intracellular signal transduction
GO:0070887	0.538	cellular response to chemical stimulus
GO:0045595	0.511	regulation of cell differentiation
GO:0071704	0.465	organic substance metabolic process
GO:0006807	0.424	nitrogen compound metabolic process
GO:0044238	0.411	primary metabolic process
GO:0044237	0.404	cellular metabolic process
GO:0009892	0.387	negative regulation of metabolic process
GO:0010605	0.384	negative regulation of macromolecule metabolic process
GO:0051172	0.358	negative regulation of nitrogen compound metabolic process
GO:0051239	0.357	regulation of multicellular organismal process
GO:0048583	0.348	regulation of response to stimulus
GO:0031324	0.345	negative regulation of cellular metabolic process
GO:0023051	0.344	regulation of signaling
GO:0010646	0.337	regulation of cell communication
GO:0071310	0.332	cellular response to organic substance
GO:0030154	0.324	cell differentiation
GO:0043170	0.314	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.999	cytoplasm
GO:0070013	0.985	intracellular organelle lumen
GO:0005654	0.979	nucleoplasm
GO:0005829	0.967	cytosol
GO:0016604	0.385	nuclear body
GO:0000785	0.359	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]