StarFunc result for job id O95678

User Input

>input (551 residues)
MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSAGASFGSR
SLYNLGGAKRVSINGCGSSCRSGFGGRASNRFGVNSGFGYGGGVGGGFSGPSFPVCPPGG
IQEVTVNQSLLTPLHLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETK
WALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDVVEDFKVRYE
DEINKRTAAENEFVALKKDVDAAYMNKVELEAKVKSLPEEINFIHSVFDAELSQLQTQVG
DTSVVLSMDNNRNLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDL
RNTKQEISEMNRMIQRLRAEIDSVKKQCSSLQTAIADAEQRGELALKDARAKLVDLEEAL
QKAKQDMARLLREYQELMNIKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTLS
SGYGSGSSIGGGNLGLGGGSGYSFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVS
TTSSSQKSYTH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95678	1.000	1.000	1.141E-66	551	1.000	1.000	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	AFDB:Q8BGZ7	0.406	0.406	1.222E-56	551	0.849	0.849	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
3	AFDB:P13647	0.520	0.491	8.502E-48	590	0.802	0.749	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
4	AFDB:P02538	0.561	0.549	4.879E-47	564	0.739	0.722	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
5	AFDB:Q922U2	0.366	0.351	3.021E-46	580	0.775	0.736	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
6	AFDB:Q9Z331	0.582	0.571	1.186E-45	562	0.728	0.714	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
7	AFDB:A0A1D5PXP0	0.373	0.392	1.579E-41	522	0.666	0.703	A0A1D5PXP0.pdb.gz
8	AFDB:Q6PVZ5	0.334	0.312	2.490E-41	599	0.679	0.624	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
9	AFDB:H2EQW7	0.257	0.280	1.144E-37	499	0.626	0.691	H2EQW7.pdb.gz	H2EQW7_CHICK Keratin 75 OS=Gallus gallus OX=9031 GN=KRT75 PE=2 SV=1
10	AFDB:P19013	0.273	0.288	7.645E-37	520	0.617	0.654	P19013.pdb.gz	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
11	PDB:6exnO	0.094	0.144	7.116	320	0.042	0.072	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
12	PDB:6lulA	0.096	0.186	9.643	224	0.022	0.054	6lulA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	H2EQW7	597	499	0.577	0.637	H2EQW7_CHICK Keratin 75 OS=Gallus gallus OX=9031 GN=KRT75 PE=2 SV=1
2	O95678	1118	551	1.000	1.000	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
3	P02538	676	564	0.652	0.637	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
4	P04259	685	564	0.652	0.637	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
5	P04264	540	644	0.456	0.390	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
6	P07744	582	525	0.559	0.587	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
7	P12035	532	628	0.468	0.411	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
8	P13647	700	590	0.673	0.629	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
9	P19013	604	520	0.570	0.604	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
10	P48668	688	564	0.655	0.640	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
11	P50446	688	553	0.711	0.709	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
12	Q01546	535	638	0.477	0.412	K22O_HUMAN Keratin, type II cytoskeletal 2 oral OS=Homo sapiens OX=9606 GN=KRT76 PE=1 SV=2
13	Q14CN4	551	511	0.546	0.589	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
14	Q29426	543	629	0.488	0.428	K2C3_RABIT Keratin, type II cytoskeletal 3 OS=Oryctolagus cuniculus OX=9986 GN=KRT3 PE=2 SV=1
15	Q3SY84	560	523	0.564	0.595	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
16	Q3UV17	545	594	0.483	0.448	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1
17	Q5XKE5	593	535	0.548	0.564	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
18	Q6IFZ5	526	581	0.468	0.444	Q6IFZ5_RAT Keratin 76 OS=Rattus norvegicus OX=10116 GN=Krt76 PE=2 SV=1
19	Q6P6Q2	694	576	0.675	0.646	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
20	Q6PVZ5	586	599	0.501	0.461	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	22	16.6	Afadin- and alpha -actinin-Binding
2	PF11839 Alanine_zipper	3.2e+02	13.1	Alanine-zipper, major outer membrane lipoprotein
3	PF04513 Baculo_PEP_C	2.1e+02	13.4	Baculovirus polyhedron envelope protein, PEP, C terminus
4	PF10473 CENP-F_leu_zip	0.0056	28.2	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
5	PF07889 DUF1664	5.4e+02	12.0	Protein of unknown function (DUF1664)
6	PF19286 DUF5909	9.4e+02	11.8	Domain of unknown function (DUF5909)
7	PF00038 Filament	2.6e-113	390.4	Intermediate filament protein
8	PF09744 Jnk-SapK_ap_N	67	15.3	JNK_SAPK-associated protein-1
9	PF14662 KASH_CCD	40	15.5	Coiled-coil region of CCDC155 or KASH
10	PF16208 Keratin_2_head	2.2e-25	101.1	Keratin type II head
11	PF03938 OmpH	1.7e+02	13.9	Outer membrane protein (OmpH-like)
12	PF18052 Rx_N	4.4e+02	12.5	Rx N-terminal domain
13	PF10824 T7SS_ESX_EspC	4.9e+02	12.6	Excreted virulence factor EspC, type VII ESX diderm
14	PF09728 Taxilin	13	16.4	Myosin-like coiled-coil protein
15	PF07926 TPR_MLP1_2	0.06	24.8	TPR/MLP1/MLP2-like protein
16	PF12718 Tropomyosin_1	2.7e+02	13.1	Tropomyosin like
17	PF08581 Tup_N	2.8e+02	13.3	Tup N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252245

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252252	0.628	Keratin, type II cytoskeletal 6B
2	9606.ENSP00000369317	0.598	Keratin, type II cytoskeletal 6A
3	9606.ENSP00000413479	0.583	Keratin, type II cytoskeletal 3
4	9606.ENSP00000252250	0.580	Keratin, type II cytoskeletal 6C
5	9606.ENSP00000264731	0.570	Tumor protein 63
6	9606.ENSP00000330101	0.565	Keratin, type II cytoskeletal 2 oral
7	9606.ENSP00000252242	0.563	Keratin, type II cytoskeletal 5
8	9606.ENSP00000337991	0.545	Protein SPT2 homolog
9	9606.ENSP00000306261	0.541	Keratin, type II cytoskeletal 78
10	9606.ENSP00000257974	0.537	Keratin, type II cuticular Hb2
11	9606.ENSP00000257951	0.534	Keratin, type II cuticular Hb4
12	9606.ENSP00000328358	0.528	Keratin, type II cytoskeletal 79
13	9606.ENSP00000448220	0.527	Keratin, type II cytoskeletal 4
14	9606.ENSP00000378292	0.526	Keratin, type II cytoskeletal 80
15	9606.ENSP00000257901	0.524	Keratin, type II cuticular Hb5
16	9606.ENSP00000369349	0.523	Keratin, type II cuticular Hb1
17	9606.ENSP00000252244	0.522	Keratin, type II cytoskeletal 1
18	9606.ENSP00000342710	0.519	Keratin, type II cytoskeletal 1b
19	9606.ENSP00000310861	0.518	Keratin, type II cytoskeletal 2 epidermal
20	9606.ENSP00000329243	0.516	Keratin, type II cytoskeletal 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.998	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0048856	0.937	anatomical structure development
GO:0071840	0.774	cellular component organization or biogenesis
GO:0009888	0.773	tissue development
GO:0016043	0.763	cellular component organization
GO:0006996	0.662	organelle organization
GO:0007010	0.619	cytoskeleton organization
GO:0032501	0.509	multicellular organismal process
GO:0065007	0.502	biological regulation
GO:0050789	0.446	regulation of biological process
GO:0050794	0.409	regulation of cellular process
GO:0045103	0.393	intermediate filament-based process
GO:0030154	0.356	cell differentiation
GO:0050896	0.307	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0070062	0.998	extracellular exosome
GO:0005882	0.997	intermediate filament
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0005634	0.971	nucleus
GO:0045095	0.933	keratin filament
GO:0016020	0.728	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]