StarFunc result for job id O95684

User Input

>input (399 residues)
MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE
SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAE
GTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQ
GKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDK
AGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAP
SLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIE
EDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95684	1.000	1.000	4.551E-52	399	1.000	1.000	O95684.pdb.gz	CEP43_HUMAN Centrosomal protein 43 OS=Homo sapiens OX=9606 GN=CEP43 PE=1 SV=1
2	AFDB:A0A087WV25	0.331	0.372	6.476E-37	351	0.822	0.934	A0A087WV25.pdb.gz	A0A087WV25_HUMAN Centrosomal protein 43 OS=Homo sapiens OX=9606 GN=CEP43 PE=1 SV=1
3	AFDB:Q38BU4	0.086	0.038	1.868E-1	1223	0.165	0.054	Q38BU4.pdb.gz	Q38BU4_TRYB2 Bilobe protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4540 PE=4 SV=1
4	AFDB:Q93XY1	0.082	0.053	2.230E-1	682	0.148	0.087	Q93XY1.pdb.gz	Q93XY1_ARATH At5g53620 OS=Arabidopsis thaliana OX=3702 GN=MNC6.16 PE=1 SV=1
5	AFDB:Q9VX37	0.075	0.054	2.230E-1	554	0.183	0.132	Q9VX37.pdb.gz	Q9VX37_DROME Corolla, isoform A OS=Drosophila melanogaster OX=7227 GN=corolla PE=2 SV=2
6	AFDB:Q19818	0.094	0.050	2.995E-1	1032	0.160	0.062	Q19818.pdb.gz	Q19818_CAEEL RING-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=nhl-2 PE=1 SV=2
7	AFDB:B3KNK9	0.080	0.080	3.371E-1	401	0.135	0.135	B3KNK9.pdb.gz	B3KNK9_HUMAN Epididymis luminal protein 46 OS=Homo sapiens OX=9606 GN=GOLPH2 PE=2 SV=1
8	AFDB:O15062	0.080	0.055	3.793E-1	677	0.145	0.086	O15062.pdb.gz	ZBTB5_HUMAN Zinc finger and BTB domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBTB5 PE=1 SV=1
9	AFDB:P34339	0.081	0.034	5.735E-1	1076	0.135	0.050	P34339.pdb.gz	EIF3A_CAEEL Eukaryotic translation initiation factor 3 subunit A OS=Caenorhabditis elegans OX=6239 GN=egl-45 PE=3 SV=1
10	AFDB:Q9P202	0.076	0.053	5.735E-1	907	0.163	0.072	Q9P202.pdb.gz	WHRN_HUMAN Whirlin OS=Homo sapiens OX=9606 GN=WHRN PE=1 SV=4
11	PDB:7aqrV	0.078	0.156	2.783	140	0.025	0.071	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
12	PDB:1keyB	0.103	0.158	4.207	221	0.065	0.118	1keyB.pdb.gz
13	PDB:1ykbD	0.085	0.146	4.463	142	0.055	0.155	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
14	PDB:5abbA	0.064	0.061	4.734	443	0.028	0.025	5abbA.pdb.gz
15	PDB:6ah0u	0.107	0.256	4.734	124	0.048	0.153	6ah0u.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
16	PDB:4gq0A	0.082	0.099	5.022	318	0.033	0.041	4gq0A.pdb.gz	Crystal structure of AKR1B10 complexed with NADP+ and Caffeic acid phenethyl ester
17	PDB:7rroB0	0.066	0.132	5.022	189	0.078	0.164	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:7ungB0	0.080	0.144	5.022	193	0.068	0.140	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:6vgcD	0.100	0.186	5.328	155	0.038	0.097	6vgcD.pdb.gz	Structure-based, multi-targeted drug discovery approach to eicosanoid inhibition: Dual inhibitors of mPGES-1 and 5-lipoxygenase activating protein (FLAP).
20	PDB:7be8A	0.076	0.122	5.328	219	0.043	0.078	7be8A.pdb.gz	Repair of Iron Center Proteins-A Different Class of Hemerythrin-like Proteins.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WV25	0.0	586	351	0.830	0.943	A0A087WV25_HUMAN Centrosomal protein 43 OS=Homo sapiens OX=9606 GN=CEP43 PE=1 SV=1
2	O95684	0.0	793	399	1.000	1.000	CEP43_HUMAN Centrosomal protein 43 OS=Homo sapiens OX=9606 GN=CEP43 PE=1 SV=1
3	Q9FQ25	1.54e-13	72.4	260	0.118	0.181	TON1A_ARATH Protein TONNEAU 1a OS=Arabidopsis thaliana OX=3702 GN=TON1A PE=1 SV=1
4	Q9FQ24	1.84e-13	72.0	257	0.115	0.179	TON1B_ARATH Protein TONNEAU 1b OS=Arabidopsis thaliana OX=3702 GN=TON1B PE=1 SV=1
5	Q386K2	9.73e-08	53.1	151	0.098	0.258	Q386K2_TRYB2 LisH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0590 PE=4 SV=1
6	I3ITH9	2.13e-06	49.3	146	0.108	0.295	I3ITH9_DANRE Fgfr1op N-terminal like OS=Danio rerio OX=7955 GN=fopnl PE=3 SV=1
7	Q388J8	3.71e-06	51.2	463	0.098	0.084	Q388J8_TRYB2 Tubulin cofactor C domain-containing protein RP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2870 PE=3 SV=1
8	Q9CZS3	1.61e-05	47.4	174	0.103	0.236	CEP20_MOUSE Centrosomal protein 20 OS=Mus musculus OX=10090 GN=Cep20 PE=1 SV=1
9	Q96NB1	6.72e-04	42.4	174	0.090	0.207	CEP20_HUMAN Centrosomal protein 20 OS=Homo sapiens OX=9606 GN=CEP20 PE=1 SV=1
10	I3NI25	0.004	40.4	198	0.075	0.152	I3NI25_HUMAN Centrosomal protein 20 OS=Homo sapiens OX=9606 GN=CEP20 PE=1 SV=1
11	A0A8I3Q5R3	0.028	39.3	1181	0.068	0.023	A0A8I3Q5R3_CANLF LisH domain-containing protein OS=Canis lupus familiaris OX=9615 GN=OFD1 PE=1 SV=1
12	P21783	0.26	36.2	2524	0.073	0.011	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
13	Q7SZK7	0.34	35.8	901	0.063	0.028	OFD1_DANRE Centriole and centriolar satellite protein ofd1 OS=Danio rerio OX=7955 GN=ofd1 PE=2 SV=1
14	A6NF31	0.36	33.9	143	0.073	0.203	A6NF31_HUMAN OFD1 centriole and centriolar satellite protein OS=Homo sapiens OX=9606 GN=OFD1 PE=1 SV=2
15	E9KL37	0.68	34.7	1012	0.073	0.029	E9KL37_HUMAN Epididymis tissue sperm binding protein Li 5a OS=Homo sapiens OX=9606 GN=OFD1 PE=2 SV=1
16	O75665	0.68	34.7	1012	0.073	0.029	OFD1_HUMAN Centriole and centriolar satellite protein OFD1 OS=Homo sapiens OX=9606 GN=OFD1 PE=1 SV=1
17	Q5CCK1	1.3	33.5	501	0.050	0.040	C90A4_ORYSJ Cytochrome P450 90A4 OS=Oryza sativa subsp. japonica OX=39947 GN=CYP90A4 PE=2 SV=1
18	A2RUV0	1.4	33.9	2522	0.073	0.011	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
19	Q80Z25	2.9	32.7	1017	0.065	0.026	OFD1_MOUSE Centriole and centriolar satellite protein OFD1 OS=Mus musculus OX=10090 GN=Ofd1 PE=1 SV=1
20	D3ZUD5	3.2	32.7	1027	0.068	0.026	D3ZUD5_RAT OFD1, centriole and centriolar satellite protein OS=Rattus norvegicus OX=10116 GN=Ofd1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09398 FOP_dimer	8.8e-25	98.1	FOP N terminal dimerisation domain
2	PF16045 LisH_2	0.0002	31.6	LisH

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221138	0.992	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
2	9606.ENSP00000418447	0.992	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
3	9606.ENSP00000356579	0.981	Centrosome-associated protein 350
4	9606.ENSP00000387209	0.904	Centrosomal protein of 19 kDa
5	9606.ENSP00000264657	0.900	Signal transducer and activator of transcription 3
6	9606.ENSP00000354394	0.900	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000261475	0.873	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
8	9606.ENSP00000229395	0.859	FGFR1 oncogene partner 2
9	9606.ENSP00000362962	0.858	Centriolin
10	9606.ENSP00000353401	0.839	Homeobox protein cut-like 1
11	9606.ENSP00000437073	0.816	Unconventional myosin-XVIIIa
12	9606.ENSP00000393312	0.793	Fibroblast growth factor receptor 1
13	9606.ENSP00000316454	0.766	Phosphofurin acidic cluster sorting protein 1
14	9606.ENSP00000479904	0.734	Zinc finger MYM-type protein 2
15	9606.ENSP00000426455	0.729	Ribonuclease T2
16	9606.ENSP00000340507	0.706	Transcription intermediary factor 1-alpha
17	9606.ENSP00000357709	0.678	Protein S100-A6
18	9606.ENSP00000244007	0.656	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
19	9606.ENSP00000341208	0.654	Signal transducer and activator of transcription 5A
20	9606.ENSP00000293328	0.653	Signal transducer and activator of transcription 5B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0019901	1.000	protein kinase binding
GO:0004860	1.000	protein kinase inhibitor activity
GO:0030292	0.983	protein tyrosine kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.985	regulation of primary metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0048523	0.980	negative regulation of cellular process
GO:0048522	0.979	positive regulation of cellular process
GO:0040012	0.972	regulation of locomotion
GO:0031399	0.965	regulation of protein modification process
GO:0065009	0.964	regulation of molecular function
GO:0042127	0.944	regulation of cell population proliferation
GO:0050790	0.934	regulation of catalytic activity
GO:0009892	0.924	negative regulation of metabolic process
GO:0042325	0.916	regulation of phosphorylation
GO:2000145	0.915	regulation of cell motility
GO:0031324	0.913	negative regulation of cellular metabolic process
GO:0040008	0.910	regulation of growth
GO:0051338	0.905	regulation of transferase activity
GO:0043549	0.903	regulation of kinase activity
GO:0051172	0.895	negative regulation of nitrogen compound metabolic process
GO:0010605	0.888	negative regulation of macromolecule metabolic process
GO:0044092	0.881	negative regulation of molecular function
GO:0001932	0.876	regulation of protein phosphorylation
GO:0051128	0.859	regulation of cellular component organization
GO:0043086	0.845	negative regulation of catalytic activity
GO:0051348	0.838	negative regulation of transferase activity
GO:0042326	0.837	negative regulation of phosphorylation
GO:0045859	0.836	regulation of protein kinase activity
GO:0033673	0.804	negative regulation of kinase activity
GO:0001558	0.784	regulation of cell growth
GO:0001933	0.780	negative regulation of protein phosphorylation
GO:0006469	0.749	negative regulation of protein kinase activity
GO:0009987	0.707	cellular process
GO:0030334	0.600	regulation of cell migration
GO:0045927	0.558	positive regulation of growth
GO:0040017	0.528	positive regulation of locomotion
GO:2000147	0.522	positive regulation of cell motility
GO:0008284	0.497	positive regulation of cell population proliferation
GO:0030335	0.449	positive regulation of cell migration
GO:0016043	0.445	cellular component organization
GO:0030307	0.360	positive regulation of cell growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005813	0.998	centrosome
GO:0043227	0.986	membrane-bounded organelle
GO:0005829	0.985	cytosol
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0005634	0.971	nucleus
GO:0005814	0.646	centriole
GO:0048471	0.461	perinuclear region of cytoplasm
GO:0012505	0.388	endomembrane system
GO:0016020	0.324	membrane
GO:0071944	0.315	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]