StarFunc result for job id O95696

User Input

>input (1058 residues)
MRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEII
LEDDLTAQEMSECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGTPASASALPEP
KVRIVEYSPPSAPRRPPVYYKFIEKSAEELDNEVEYDMDEEDYAWLEIVNEKRKGDCVPA
VSQSMFEFLMDRFEKESHCENQKQGEQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLA
VHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGAFKKTDDDRWGHVVCALWIPE
VGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGL
YMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKESSVKTV
RSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYW
LLKRLSRNGAPLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIE
LLRKREKLKREQVKVEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYL
DHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGG
VVLRQARREVDSIGLEEASGMHLPERPAAAPRRPFSWEDVDRLLDPANRAHLGLEEQLRE
LLDMLDLTCAMKSSGSRSKRAKLLKKEIALLRNKLSQQHSQPLPTGPGLEGFEEDGAALG
PEAGEEVLPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDAGLTNGFGGARSEQEPGGGL
GRKATPRRRCASESSISSSNSPLCDSSFNAPKCGRGKPALVRRHTLEDRSELISCIENGN
YAKAARIAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHN
GVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKM
MEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSDLSDID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4V5	0.323	0.292	0.000	1189	0.999	0.889	A0A024R4V5.pdb.gz
2	AFDB:A0A024R4W4	0.420	0.420	0.000	1058	1.000	1.000	A0A024R4W4.pdb.gz
3	AFDB:Q9ULD4	0.399	0.360	2.452E-100	1205	0.578	0.508	Q9ULD4.pdb.gz	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
4	AFDB:P55201	0.316	0.282	8.303E-98	1214	0.552	0.481	P55201.pdb.gz	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
5	AFDB:A0A5F9ZH11	0.318	0.277	1.960E-95	1253	0.551	0.465	A0A5F9ZH11.pdb.gz	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
6	AFDB:B2YCZ4	0.245	0.216	1.767E-92	1258	0.540	0.454	B2YCZ4.pdb.gz
7	AFDB:O74759	0.199	0.260	2.507E-29	767	0.175	0.241	O74759.pdb.gz	NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nto1 PE=1 SV=1
8	AFDB:Q12311	0.268	0.366	5.338E-27	748	0.161	0.227	Q12311.pdb.gz	NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTO1 PE=1 SV=1
9	AFDB:A0A0C4DFT8	0.197	0.254	3.657E-25	791	0.182	0.244	A0A0C4DFT8.pdb.gz	A0A0C4DFT8_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
10	AFDB:A0A0B4KGP1	0.173	0.110	1.742E-11	1717	0.088	0.054	A0A0B4KGP1.pdb.gz	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
11	PDB:1keyB	0.054	0.223	1.056E-1	221	0.031	0.149	1keyB.pdb.gz
12	PDB:3axjA	0.056	0.183	3.454E-1	225	0.034	0.160	3axjA.pdb.gz
13	PDB:3axjB	0.057	0.199	3.637E-1	240	0.025	0.108	3axjB.pdb.gz
14	PDB:6w1sS	0.057	0.064	7.108E-1	901	0.022	0.026	6w1sS.pdb.gz	A Pliable Mediator Acts as a Functional Rather Than an Architectural Bridge between Promoters and Enhancers.
15	PDB:4pz6A	0.054	0.122	7.880E-1	373	0.011	0.032	4pz6A.pdb.gz	How an mRNA capping enzyme reads distinct RNA polymerase II and Spt5 CTD phosphorylation codes.
16	PDB:7tveG	0.055	0.147	1.074	307	0.026	0.091	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
17	PDB:4v8mBv	0.046	0.262	1.130	157	0.010	0.070	4v8mBv.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
18	PDB:7ungC1	0.061	0.153	1.253	336	0.048	0.152	7ungC1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:8dvsA	0.065	0.092	1.540	682	0.016	0.025	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
20	PDB:6v8oO	0.070	0.174	1.622	384	0.036	0.099	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5F9ZH11	0.0	922	1253	0.434	0.366	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
2	B2RRD7	0.0	936	1212	0.438	0.382	BRPF1_MOUSE Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1
3	D3ZUW8	0.0	1524	1189	0.707	0.629	D3ZUW8_RAT Bromodomain containing 1 OS=Rattus norvegicus OX=10116 GN=Brd1 PE=4 SV=3
4	G5E8P1	0.0	2046	1058	0.953	0.953	BRD1_MOUSE Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1
5	O95696	0.0	2192	1058	1.000	1.000	BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1
6	P55201	0.0	929	1214	0.433	0.377	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
7	Q7JVP4	0.0	632	1430	0.318	0.235	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
8	Q803M2	0.0	835	899	0.420	0.494	Q803M2_DANRE Bromodomain and PHD finger containing, 1 OS=Danio rerio OX=7955 GN=zgc:55530 PE=2 SV=1
9	Q9ULD4	0.0	907	1205	0.440	0.387	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
10	Q12311	9.34e-67	241	748	0.144	0.203	NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTO1 PE=1 SV=1
11	O74759	2.33e-61	226	767	0.164	0.227	NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nto1 PE=1 SV=1
12	Q6IE81	1.95e-58	219	842	0.146	0.183	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
13	Q92613	1.03e-56	213	823	0.145	0.186	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
14	A0A0C4DFT8	4.19e-56	211	791	0.138	0.185	A0A0C4DFT8_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
15	Q9NQC1	4.85e-56	211	790	0.138	0.185	JADE2_HUMAN E3 ubiquitin-protein ligase Jade-2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
16	G3XAA4	8.25e-56	211	834	0.138	0.175	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
17	A0A087X085	8.55e-56	211	833	0.138	0.175	A0A087X085_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
18	Q6ZQF7	8.16e-55	207	829	0.139	0.177	JADE2_MOUSE E3 ubiquitin-protein ligase Jade-2 OS=Mus musculus OX=10090 GN=Jade2 PE=1 SV=2
19	Q803A0	2.16e-53	203	829	0.128	0.163	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1
20	Q7YZH1	1.66e-49	195	3241	0.095	0.031	RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster OX=7227 GN=rno PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13476 AAA_23	89	15.0	AAA domain
2	PF00439 Bromodomain	4e-21	86.2	Bromodomain
3	PF10513 EPL1	1.6e-30	118.4	Enhancer of polycomb-like
4	PF00628 PHD	0.0015	29.7	PHD-finger
5	PF13831 PHD_2	2.5e-10	50.9	PHD-finger
6	PF00855 PWWP	9.9e-10	50.1	PWWP domain
7	PF13771 zf-HC5HC2H	9.1e-23	91.7	PHD-like zinc-binding domain
8	PF13832 zf-HC5HC2H_2	1.1e-33	127.0	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216267

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259021	0.999	Histone acetyltransferase KAT7
2	9606.ENSP00000380136	0.999	Histone acetyltransferase KAT6A
3	9606.ENSP00000287239	0.997	Histone acetyltransferase KAT6B
4	9606.ENSP00000322142	0.997	Inhibitor of growth protein 5
5	9606.ENSP00000362166	0.997	Chromatin modification-related protein MEAF6
6	9606.ENSP00000349508	0.964	Chromodomain-helicase-DNA-binding protein 4
7	9606.ENSP00000369716	0.936	Chromodomain-helicase-DNA-binding protein 3
8	9606.ENSP00000362649	0.930	Histone deacetylase 1
9	9606.ENSP00000430432	0.926	Histone deacetylase 2
10	9606.ENSP00000350267	0.919	Bromodomain and PHD finger-containing protein 3
11	9606.ENSP00000451828	0.915	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000362592	0.911	Histone-binding protein RBBP4
13	9606.ENSP00000369424	0.910	Histone-binding protein RBBP7
14	9606.ENSP00000353463	0.909	Transcriptional repressor p66-alpha
15	9606.ENSP00000373340	0.908	Peregrin
16	9606.ENSP00000375892	0.905	RAC-beta serine/threonine-protein kinase
17	9606.ENSP00000263826	0.903	RAC-gamma serine/threonine-protein kinase
18	9606.ENSP00000278823	0.903	Metastasis-associated protein MTA2
19	9606.ENSP00000357644	0.902	Transcriptional repressor p66-beta
20	9606.ENSP00000412302	0.902	Methyl-CpG-binding domain protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0010485	0.999	histone H4 acetyltransferase activity
GO:0010484	0.997	histone H3 acetyltransferase activity
GO:0060090	0.993	molecular adaptor activity
GO:0042393	0.976	histone binding
GO:0030674	0.815	protein-macromolecule adaptor activity
GO:0140463	0.804	chromatin-protein adaptor activity
GO:0043997	0.693	histone H4K12 acetyltransferase activity
GO:0043996	0.683	histone H4K8 acetyltransferase activity
GO:0043995	0.683	histone H4K5 acetyltransferase activity
GO:0036408	0.423	histone H3K14 acetyltransferase activity
GO:0140110	0.379	transcription regulator activity
GO:0097159	0.319	organic cyclic compound binding
GO:1901363	0.318	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0048518	0.903	positive regulation of biological process
GO:0048522	0.880	positive regulation of cellular process
GO:0019222	0.825	regulation of metabolic process
GO:0060255	0.784	regulation of macromolecule metabolic process
GO:0080090	0.774	regulation of primary metabolic process
GO:0051171	0.774	regulation of nitrogen compound metabolic process
GO:0031323	0.774	regulation of cellular metabolic process
GO:0019219	0.754	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.596	organic substance metabolic process
GO:0009987	0.595	cellular process
GO:0044238	0.571	primary metabolic process
GO:0050793	0.561	regulation of developmental process
GO:0051252	0.541	regulation of RNA metabolic process
GO:0043170	0.529	macromolecule metabolic process
GO:0006807	0.523	nitrogen compound metabolic process
GO:0006355	0.517	regulation of DNA-templated transcription
GO:0009893	0.516	positive regulation of metabolic process
GO:0010604	0.509	positive regulation of macromolecule metabolic process
GO:0031325	0.497	positive regulation of cellular metabolic process
GO:0051173	0.494	positive regulation of nitrogen compound metabolic process
GO:0051239	0.490	regulation of multicellular organismal process
GO:0045935	0.463	positive regulation of nucleobase-containing compound metabolic process
GO:0060284	0.434	regulation of cell development
GO:0019538	0.425	protein metabolic process
GO:0036211	0.423	protein modification process
GO:0002682	0.376	regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005694	0.997	chromosome
GO:0000785	0.994	chromatin
GO:1990234	0.993	transferase complex
GO:0016607	0.951	nuclear speck
GO:0000123	0.925	histone acetyltransferase complex
GO:0140513	0.907	nuclear protein-containing complex
GO:0070775	0.745	H3 histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]