StarFunc result for job id O95714

User Input

>input (1400 residues)
MPSESFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPP
RKDDSVEPSGTKKEDLNDKEKKDEEETPAPIYRAKSILDSWVWGKQPDVNELKECLSVLV
KEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSGISLPPVDKK
SSRPAGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASL
FDESTVSSVWLEVVERATRFLRSVVTGDVHGTPATKGPGSIPLQDQHLALAILLELAVQR
GTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICRKDAPHSEGDM
HLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKG
SLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSD
TLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKV
ISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGL
KGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVV
KVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTH
CLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCS
EWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGSADWPPPQEKECVAVATLNLLRLQL
HAAISHQVDPEFLGLGLGSILLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLPT
AEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALHAAITAEIQDIE
AKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGICESSGKQCLPLVQLIQQLLRNIA
SQTVARLKDVARRISSCLDFEQHSRERSASLDLLLRFQRLLISKLYPGESIGQTSDISSP
ELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVAYIVEGDFTGVLLPELVVS
IVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQN
CRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVA
LEAALQFEDTRESMHAFCVGQYLEPDQEIVTIPDLGSLSSPLIDTERNLGLLLGLHASYL
AMSTPLSPVEIECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSH
RRALGDHSQAFLQAIADNNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BNF7	0.423	0.481	1.504E-58	1203	0.239	0.278	Q8BNF7.pdb.gz	Q8BNF7_MOUSE E3 ubiquitin-protein ligase HERC1 (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=2
2	AFDB:Q55CR5	0.242	0.170	1.676E-27	2044	0.139	0.095	Q55CR5.pdb.gz	Q55CR5_DICDI Regulator of chromosome condensation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269934 PE=4 SV=1
3	AFDB:Q5GLZ8	0.239	0.314	2.334E-27	1057	0.129	0.171	Q5GLZ8.pdb.gz	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
4	AFDB:E8NHA2	0.240	0.314	2.572E-26	1062	0.116	0.153	E8NHA2.pdb.gz	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
5	AFDB:Q9FJG9	0.229	0.694	1.205E-24	445	0.071	0.222	Q9FJG9.pdb.gz	RUG3_ARATH RCC1 domain-containing protein RUG3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RUG3 PE=1 SV=1
6	AFDB:Q947D2	0.232	0.293	1.365E-24	1103	0.091	0.116	Q947D2.pdb.gz	PRAF1_ARATH PH, RCC1 and FYVE domains-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PRAF1 PE=1 SV=1
7	AFDB:Q9SRZ7	0.239	0.328	2.995E-24	1006	0.086	0.120	Q9SRZ7.pdb.gz	Q9SRZ7_ARATH F12P19.9 protein OS=Arabidopsis thaliana OX=3702 GN=At1g65920 PE=1 SV=1
8	AFDB:Q9FN03	0.215	0.671	5.571E-24	440	0.071	0.227	Q9FN03.pdb.gz	UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
9	AFDB:Q91ZR4	0.232	0.452	1.443E-23	698	0.081	0.163	Q91ZR4.pdb.gz	NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus OX=10090 GN=Nek8 PE=1 SV=1
10	PDB:8gqeB	0.217	0.768	1.970E-23	386	0.071	0.256	8gqeB.pdb.gz
11	AFDB:Q54PV1	0.224	0.175	2.370E-23	1800	0.067	0.052	Q54PV1.pdb.gz	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1
12	PDB:5tbkI	0.217	0.680	2.710E-18	419	0.064	0.212	5tbkI.pdb.gz
13	PDB:5xgsA	0.224	0.746	5.706E-18	398	0.068	0.239	5xgsA.pdb.gz
14	PDB:5t94A	0.229	0.672	1.061E-17	454	0.059	0.183	5t94A.pdb.gz
15	PDB:4d4oA	0.196	0.611	4.281E-12	414	0.045	0.152	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
16	PDB:7mq8LR	0.143	0.242	1.545E-8	773	0.059	0.106	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7uwfA	0.134	0.426	7.142E-8	361	0.034	0.133	7uwfA.pdb.gz
18	PDB:7mq8LS	0.160	0.427	1.634E-7	453	0.040	0.124	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7d5sB2	0.142	0.218	2.471E-7	851	0.049	0.081	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:7ajtUO	0.145	0.361	2.915E-7	493	0.056	0.158	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95714	0.0	2860	4834	1.000	0.290	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
2	Q4U2R1	0.0	2652	4836	0.957	0.277	HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
3	Q8BNF7	9.49e-67	250	1203	0.126	0.146	Q8BNF7_MOUSE E3 ubiquitin-protein ligase HERC1 (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=2
4	Q15751	1.08e-66	252	4861	0.127	0.037	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
5	E9PZP8	4.39e-66	250	4859	0.126	0.036	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
6	Q947D2	5.76e-40	164	1103	0.087	0.111	PRAF1_ARATH PH, RCC1 and FYVE domains-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PRAF1 PE=1 SV=1
7	Q9FN03	8.43e-40	156	440	0.070	0.223	UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
8	E8NHA2	2.01e-37	155	1062	0.074	0.097	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
9	Q9SRZ7	7.09e-36	150	1006	0.083	0.115	Q9SRZ7_ARATH F12P19.9 protein OS=Arabidopsis thaliana OX=3702 GN=At1g65920 PE=1 SV=1
10	Q9LFS0	5.03e-35	141	396	0.072	0.255	Q9LFS0_ARATH At5g16040 OS=Arabidopsis thaliana OX=3702 GN=At5g16040 PE=1 SV=1
11	Q6PAV2	5.93e-34	144	1057	0.066	0.088	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
12	O95199	6.91e-34	140	551	0.064	0.162	RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RCBTB2 PE=1 SV=1
13	Q99LJ7	1.10e-33	140	551	0.062	0.158	RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rcbtb2 PE=1 SV=1
14	Q7ZVG0	1.91e-33	139	531	0.058	0.153	Q7ZVG0_DANRE RCC1 and BTB domain-containing protein 1 OS=Danio rerio OX=7955 GN=wu:fj43a07 PE=1 SV=1
15	B8A4R1	2.08e-33	139	531	0.058	0.153	B8A4R1_DANRE RCC1 and BTB domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=fj43a07 PE=1 SV=1
16	Q5GLZ8	4.83e-33	141	1057	0.065	0.086	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
17	Q55CR5	2.55e-32	140	2044	0.056	0.039	Q55CR5_DICDI Regulator of chromosome condensation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269934 PE=4 SV=1
18	Q8NDN9	2.20e-31	133	531	0.064	0.168	RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RCBTB1 PE=1 SV=1
19	Q9FJG9	3.42e-31	130	445	0.067	0.211	RUG3_ARATH RCC1 domain-containing protein RUG3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RUG3 PE=1 SV=1
20	Q0WSJ9	4.47e-30	126	393	0.070	0.249	Q0WSJ9_ARATH Regulator of chromosome condensation (RCC1) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g02510 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00173 Cyt-b5	7.1e-07	40.6	Cytochrome b5-like Heme/Steroid binding domain
2	PF17530 NS3	5.9e+02	11.4	Non-structural protein NS3
3	PF00415 RCC1	2.2e-64	225.1	Regulator of chromosome condensation (RCC1) repeat
4	PF13540 RCC1_2	1.3e-28	109.4	Regulator of chromosome condensation (RCC1) repeat
5	PF14433 SUKH-3	1.1e+02	14.7	SUKH-3 immunity protein
6	PF01209 Ubie_methyltran	5.1e+02	11.4	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261609

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362578	0.974	E3 ubiquitin-protein ligase RNF8
2	9606.ENSP00000382390	0.946	Neuralized-like protein 4
3	9606.ENSP00000232165	0.913	Ubiquitin-protein ligase E3A
4	9606.ENSP00000463027	0.912	Nuclear receptor coactivator 4
5	9606.ENSP00000012443	0.910	Serine/threonine-protein phosphatase 5
6	9606.ENSP00000348056	0.901	SUMO-conjugating enzyme UBC9
7	9606.ENSP00000262971	0.895	E3 SUMO-protein ligase PIAS4
8	9606.ENSP00000418960	0.882	Breast cancer type 1 susceptibility protein
9	9606.ENSP00000313811	0.869	Ubiquitin carboxyl-terminal hydrolase 20
10	9606.ENSP00000316176	0.854	Ubiquitin-conjugating enzyme E2 N
11	9606.ENSP00000254719	0.840	Replication protein A 70 kDa DNA-binding subunit
12	9606.ENSP00000262189	0.822	Histone-lysine N-methyltransferase 2C
13	9606.ENSP00000376077	0.813	Small ubiquitin-related modifier 1
14	9606.ENSP00000320898	0.799	E3 ubiquitin-protein ligase RNF168
15	9606.ENSP00000369857	0.786	BRCA1-A complex subunit Abraxas 1
16	9606.ENSP00000304854	0.785	NudC domain-containing protein 2
17	9606.ENSP00000344866	0.780	F-box/LRR-repeat protein 5
18	9606.ENSP00000308944	0.778	Helicase-like transcription factor
19	9606.ENSP00000365588	0.775	Mediator of DNA damage checkpoint protein 1
20	9606.ENSP00000233027	0.771	Serine/threonine-protein kinase Nek4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044389	0.995	ubiquitin-like protein ligase binding
GO:0004842	0.995	ubiquitin-protein transferase activity
GO:0031625	0.994	ubiquitin protein ligase binding
GO:0032183	0.992	SUMO binding
GO:0061659	0.992	ubiquitin-like protein ligase activity
GO:0030234	0.855	enzyme regulator activity
GO:0140677	0.854	molecular function activator activity
GO:0061630	0.853	ubiquitin protein ligase activity
GO:1901363	0.843	heterocyclic compound binding
GO:0097159	0.843	organic cyclic compound binding
GO:0030695	0.528	GTPase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0019538	0.990	protein metabolic process
GO:0009987	0.923	cellular process
GO:0044237	0.801	cellular metabolic process
GO:0070647	0.698	protein modification by small protein conjugation or removal
GO:0006508	0.653	proteolysis
GO:0009056	0.584	catabolic process
GO:0044260	0.570	cellular macromolecule metabolic process
GO:1901575	0.542	organic substance catabolic process
GO:0044265	0.515	cellular macromolecule catabolic process
GO:0043632	0.510	modification-dependent macromolecule catabolic process
GO:1901565	0.500	organonitrogen compound catabolic process
GO:0050896	0.441	response to stimulus
GO:0051603	0.398	proteolysis involved in protein catabolic process
GO:0000003	0.374	reproduction
GO:0032501	0.338	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005654	0.989	nucleoplasm
GO:0016020	0.981	membrane
GO:0005829	0.880	cytosol
GO:0071944	0.625	cell periphery
GO:0005886	0.593	plasma membrane
GO:0031090	0.568	organelle membrane
GO:0031975	0.517	envelope
GO:0031967	0.480	organelle envelope
GO:0005739	0.378	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.995	Transferases.

[back to server]