StarFunc result for job id O95718

User Input

>input (433 residues)
MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPP
MFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASC
EACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRG
GRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKAL
TTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLV
YAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDL
EAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP
MHKLFLEMLEAKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Y491	0.527	0.503	1.105E-54	454	1.000	0.954	A0A2R8Y491.pdb.gz	A0A2R8Y491_HUMAN Estrogen related receptor beta OS=Homo sapiens OX=9606 GN=ESRRB PE=1 SV=1
2	AFDB:F6PD98	0.518	0.448	3.941E-47	501	0.771	0.667	F6PD98.pdb.gz	F6PD98_DANRE Estrogen-related receptor gamma a OS=Danio rerio OX=7955 GN=errg PE=3 SV=1
3	AFDB:Q6Q6F6	0.530	0.527	9.616E-41	436	0.619	0.615	Q6Q6F6.pdb.gz	Q6Q6F6_DANRE Estrogen-related receptor alpha OS=Danio rerio OX=7955 GN=erralpha PE=1 SV=1
4	AFDB:Q6Q6F3	0.516	0.648	2.508E-33	344	0.476	0.599	Q6Q6F3.pdb.gz
5	AFDB:P16058	0.503	0.373	1.914E-27	622	0.365	0.254	P16058.pdb.gz	ESR1_ONCMY Estrogen receptor OS=Oncorhynchus mykiss OX=8022 GN=esr1 PE=2 SV=3
6	AFDB:Q9YHZ7	0.582	0.421	7.653E-27	617	0.374	0.263	Q9YHZ7.pdb.gz	ESR1_ICTPU Estrogen receptor OS=Ictalurus punctatus OX=7998 GN=esr1 PE=2 SV=2
7	AFDB:Q7ZU32	0.515	0.417	8.751E-27	553	0.356	0.278	Q7ZU32.pdb.gz	Q7ZU32_DANRE Esr2a protein OS=Danio rerio OX=7955 GN=ER[b]2 PE=2 SV=1
8	AFDB:P49884	0.491	0.367	4.375E-26	596	0.370	0.268	P49884.pdb.gz	ESR1_BOVIN Estrogen receptor OS=Bos taurus OX=9913 GN=ESR1 PE=1 SV=3
9	AFDB:P06211	0.526	0.400	9.145E-25	600	0.360	0.260	P06211.pdb.gz	ESR1_RAT Estrogen receptor OS=Rattus norvegicus OX=10116 GN=Esr1 PE=1 SV=1
10	AFDB:A0A0S2Z570	0.472	0.397	7.476E-24	537	0.314	0.253	A0A0S2Z570.pdb.gz	A0A0S2Z570_HUMAN RXRB (Fragment) OS=Homo sapiens OX=9606 GN=RXRB PE=2 SV=1
11	PDB:3dzyA	0.449	0.632	3.311E-18	302	0.249	0.358	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.456	0.797	8.260E-11	238	0.145	0.265	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.412	0.709	1.010E-9	246	0.120	0.211	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.431	0.700	7.218E-9	259	0.132	0.220	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7wq3R	0.115	0.154	2.059E-1	289	0.067	0.100	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
16	PDB:1qoyA	0.065	0.080	2.944E-1	303	0.085	0.122	1qoyA.pdb.gz
17	PDB:3fr8B	0.104	0.094	3.367E-1	517	0.065	0.054	3fr8B.pdb.gz	Conformational changes in a plant ketol-acid reductoisomerase upon Mg(2+) and NADPH binding as revealed by two crystal structures
18	PDB:7td3R	0.095	0.127	4.402E-1	292	0.065	0.096	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
19	PDB:6g79S	0.122	0.177	4.604E-1	262	0.060	0.099	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
20	PDB:7p5cA	0.102	0.110	5.757E-1	392	0.085	0.094	7p5cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y491	0.0	886	454	1.000	0.954	A0A2R8Y491_HUMAN Estrogen related receptor beta OS=Homo sapiens OX=9606 GN=ESRRB PE=1 SV=1
2	B3DIZ0	0.0	536	420	0.651	0.671	B3DIZ0_DANRE Estrogen-related receptor gamma b OS=Danio rerio OX=7955 GN=errbeta/gamma PE=2 SV=1
3	E7EWD9	0.0	888	438	1.000	0.989	E7EWD9_HUMAN Estrogen related receptor beta OS=Homo sapiens OX=9606 GN=ESRRB PE=1 SV=2
4	F6PD98	0.0	675	501	0.774	0.669	F6PD98_DANRE Estrogen-related receptor gamma a OS=Danio rerio OX=7955 GN=errg PE=3 SV=1
5	O95718	0.0	888	433	1.000	1.000	ERR2_HUMAN Steroid hormone receptor ERR2 OS=Homo sapiens OX=9606 GN=ESRRB PE=1 SV=3
6	P11475	0.0	835	433	0.956	0.956	ERR2_RAT Steroid hormone receptor ERR2 OS=Rattus norvegicus OX=10116 GN=Esrrb PE=2 SV=1
7	P62508	0.0	694	458	0.785	0.742	ERR3_HUMAN Estrogen-related receptor gamma OS=Homo sapiens OX=9606 GN=ESRRG PE=1 SV=1
8	P62509	0.0	694	458	0.785	0.742	ERR3_MOUSE Estrogen-related receptor gamma OS=Mus musculus OX=10090 GN=Esrrg PE=1 SV=1
9	Q5RJ38	0.0	536	444	0.651	0.635	Q5RJ38_DANRE Estrogen-related receptor gamma b OS=Danio rerio OX=7955 GN=errb/g PE=3 SV=2
10	Q61539	0.0	813	433	0.931	0.931	ERR2_MOUSE Steroid hormone receptor ERR2 OS=Mus musculus OX=10090 GN=Esrrb PE=1 SV=2
11	Q6Q6F4	0.0	675	435	0.774	0.770	Q6Q6F4_DANRE Estrogen-related receptor gamma OS=Danio rerio OX=7955 GN=errgamma PE=2 SV=1
12	Q6Q6F6	1.48e-171	489	436	0.564	0.560	Q6Q6F6_DANRE Estrogen-related receptor alpha OS=Danio rerio OX=7955 GN=erralpha PE=1 SV=1
13	O08580	4.03e-161	462	422	0.575	0.590	ERR1_MOUSE Steroid hormone receptor ERR1 OS=Mus musculus OX=10090 GN=Esrra PE=1 SV=4
14	Q5QJV7	4.03e-161	462	422	0.575	0.590	ERR1_RAT Steroid hormone receptor ERR1 OS=Rattus norvegicus OX=10116 GN=Esrra PE=1 SV=2
15	P11474	1.38e-159	458	423	0.582	0.596	ERR1_HUMAN Steroid hormone receptor ERR1 OS=Homo sapiens OX=9606 GN=ESRRA PE=1 SV=3
16	Q569H8	1.38e-159	458	423	0.582	0.596	Q569H8_HUMAN ESRRA protein OS=Homo sapiens OX=9606 GN=ESRRA PE=2 SV=1
17	A0A6E1WCP9	2.01e-159	461	506	0.580	0.496	A0A6E1WCP9_HUMAN Estrogen related receptor alpha OS=Homo sapiens OX=9606 GN=ESRRA PE=1 SV=1
18	Q9VSE9	4.87e-92	288	484	0.395	0.353	Q9VSE9_DROME Estrogen-related receptor OS=Drosophila melanogaster OX=7227 GN=ERR PE=1 SV=1
19	Q8WS79	6.81e-92	288	496	0.395	0.345	Q8WS79_DROME Estrogen-related receptor splice variant OS=Drosophila melanogaster OX=7227 GN=ERR PE=2 SV=1
20	E5L8C9	1.40e-83	269	589	0.386	0.284	E5L8C9_CHICK Estrogen receptor OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	3.1e-26	103.8	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	2.5e-27	106.4	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000422488

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259915	0.995	POU domain, class 5, transcription factor 1
2	9606.ENSP00000229307	0.973	Homeobox protein NANOG
3	9606.ENSP00000361066	0.901	Nuclear receptor coactivator 3
4	9606.ENSP00000263707	0.892	Transcription factor CP2-like protein 1
5	9606.ENSP00000323588	0.886	Transcription factor SOX-2
6	9606.ENSP00000217086	0.828	Sal-like protein 4
7	9606.ENSP00000419298	0.821	Putative POU domain, class 5, transcription factor 1B
8	9606.ENSP00000368253	0.816	Nuclear receptor subfamily 0 group B member 1
9	9606.ENSP00000363804	0.806	Krueppel-like factor 4
10	9606.ENSP00000257566	0.780	T-box transcription factor TBX3
11	9606.ENSP00000317686	0.766	Zinc finger protein 42 homolog
12	9606.ENSP00000305906	0.728	Undifferentiated embryonic cell transcription factor 1
13	9606.ENSP00000276594	0.711	PR domain zinc finger protein 14
14	9606.ENSP00000366915	0.707	Krueppel-like factor 5
15	9606.ENSP00000248071	0.706	Krueppel-like factor 2
16	9606.ENSP00000482760	0.699	Proprotein convertase subtilisin/kexin type 6
17	9606.ENSP00000368475	0.698	Zinc finger X-chromosomal protein
18	9606.ENSP00000370128	0.689	High affinity cationic amino acid transporter 1
19	9606.ENSP00000385036	0.686	T-cell leukemia/lymphoma protein 1A
20	9606.ENSP00000362748	0.680	Methylcytosine dioxygenase TET1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	0.999	sequence-specific DNA binding
GO:0003690	0.999	double-stranded DNA binding
GO:0005515	0.998	protein binding
GO:0000981	0.985	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.972	sequence-specific double-stranded DNA binding
GO:0038023	0.918	signaling receptor activity
GO:0000976	0.861	transcription cis-regulatory region binding
GO:0000977	0.596	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008134	0.584	transcription factor binding
GO:0000987	0.497	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.487	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0098531	0.471	ligand-activated transcription factor activity
GO:0004879	0.341	nuclear receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.997	regulation of metabolic process
GO:0009889	0.989	regulation of biosynthetic process
GO:0051252	0.986	regulation of RNA metabolic process
GO:0009987	0.957	cellular process
GO:0010556	0.950	regulation of macromolecule biosynthetic process
GO:0031326	0.948	regulation of cellular biosynthetic process
GO:2001141	0.938	regulation of RNA biosynthetic process
GO:0010468	0.936	regulation of gene expression
GO:0006355	0.891	regulation of DNA-templated transcription
GO:0032502	0.849	developmental process
GO:0048518	0.848	positive regulation of biological process
GO:0048522	0.768	positive regulation of cellular process
GO:0009893	0.758	positive regulation of metabolic process
GO:0032501	0.745	multicellular organismal process
GO:0031325	0.715	positive regulation of cellular metabolic process
GO:0010604	0.695	positive regulation of macromolecule metabolic process
GO:0051173	0.634	positive regulation of nitrogen compound metabolic process
GO:0048856	0.618	anatomical structure development
GO:0009891	0.465	positive regulation of biosynthetic process
GO:0031328	0.463	positive regulation of cellular biosynthetic process
GO:0006357	0.456	regulation of transcription by RNA polymerase II
GO:0045935	0.448	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.441	positive regulation of macromolecule biosynthetic process
GO:1903508	0.415	positive regulation of nucleic acid-templated transcription
GO:0045893	0.414	positive regulation of DNA-templated transcription
GO:0050896	0.404	response to stimulus
GO:0007275	0.394	multicellular organism development
GO:0045944	0.369	positive regulation of transcription by RNA polymerase II
GO:0048519	0.342	negative regulation of biological process
GO:0048523	0.326	negative regulation of cellular process
GO:0008152	0.304	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.931	cytoplasm
GO:0005829	0.924	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]