StarFunc result for job id O95727

User Input

>input (393 residues)
MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFL
NEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFK
PILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTT
STLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQ
PTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSGILLLTLVSFLIFI
LFIIVQLFIMKLRKAHVIWKKENEVSEHTLESYRSRSNNEETSSEEKNGQSSHPMRCMNY
ITKLYSEAKTKRKENVQHSKLEEKHIQVPESIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95727	1.000	1.000	3.974E-63	393	1.000	1.000	O95727.pdb.gz	CRTAM_HUMAN Cytotoxic and regulatory T-cell molecule OS=Homo sapiens OX=9606 GN=CRTAM PE=1 SV=2
2	AFDB:Q149L7	0.547	0.547	3.963E-43	393	0.690	0.690	Q149L7.pdb.gz	CRTAM_MOUSE Cytotoxic and regulatory T-cell molecule OS=Mus musculus OX=10090 GN=Crtam PE=1 SV=2
3	AFDB:F1NWM4	0.480	0.432	9.649E-30	439	0.372	0.333	F1NWM4.pdb.gz
4	AFDB:Q8N126	0.447	0.442	4.334E-18	398	0.165	0.163	Q8N126.pdb.gz	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
5	AFDB:Q1WIM2	0.450	0.409	9.133E-18	435	0.204	0.184	Q1WIM2.pdb.gz	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
6	AFDB:Q6AYP5	0.407	0.339	2.478E-16	476	0.176	0.145	Q6AYP5.pdb.gz	CADM1_RAT Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=1 SV=1
7	AFDB:Q8R5M8	0.417	0.363	5.220E-16	456	0.186	0.160	Q8R5M8.pdb.gz	CADM1_MOUSE Cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Cadm1 PE=1 SV=2
8	AFDB:B0CLV6	0.434	0.407	1.043E-15	420	0.148	0.138	B0CLV6.pdb.gz	B0CLV6_DANRE Cell adhesion molecule 3 OS=Danio rerio OX=7955 GN=zgc:136589 PE=1 SV=1
9	AFDB:Q6PFK4	0.435	0.422	2.084E-15	405	0.142	0.138	Q6PFK4.pdb.gz	Q6PFK4_DANRE Cell adhesion molecule 2a OS=Danio rerio OX=7955 GN=zgc:66339 PE=1 SV=1
10	AFDB:F1QF23	0.423	0.425	3.548E-15	391	0.142	0.143	F1QF23.pdb.gz
11	PDB:6dlfA	0.353	0.564	2.779E-11	236	0.109	0.182	6dlfA.pdb.gz
12	PDB:6dldD	0.347	0.496	7.245E-11	269	0.097	0.141	6dldD.pdb.gz
13	PDB:3o3uN	0.365	0.257	9.972E-11	580	0.097	0.066	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
14	PDB:4fqqL	0.243	0.390	1.052E-10	213	0.092	0.169	4fqqL.pdb.gz
15	PDB:1aqkL	0.254	0.387	2.742E-10	216	0.089	0.162	1aqkL.pdb.gz
16	PDB:1jnhA	0.210	0.353	4.427E-10	208	0.081	0.154	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
17	PDB:3tygL	0.238	0.374	4.925E-10	207	0.092	0.174	3tygL.pdb.gz	A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
18	PDB:4r2gP	0.243	0.389	5.194E-10	210	0.081	0.152	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
19	PDB:6vpyL	0.220	0.379	5.194E-10	209	0.089	0.167	6vpyL.pdb.gz
20	PDB:1q0xL	0.261	0.388	8.845E-10	212	0.076	0.142	1q0xL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95727	0.0	809	393	1.000	1.000	CRTAM_HUMAN Cytotoxic and regulatory T-cell molecule OS=Homo sapiens OX=9606 GN=CRTAM PE=1 SV=2
2	Q149L7	0.0	562	393	0.715	0.715	CRTAM_MOUSE Cytotoxic and regulatory T-cell molecule OS=Mus musculus OX=10090 GN=Crtam PE=1 SV=2
3	O57349	6.31e-82	259	439	0.407	0.364	O57349_CHICK Thymocyte activation and developmental protein OS=Gallus gallus OX=9031 PE=2 SV=1
4	Q99N28	1.85e-20	94.4	396	0.160	0.159	CADM3_MOUSE Cell adhesion molecule 3 OS=Mus musculus OX=10090 GN=Cadm3 PE=1 SV=1
5	Q6PFK4	5.95e-20	92.8	405	0.148	0.143	Q6PFK4_DANRE Cell adhesion molecule 2a OS=Danio rerio OX=7955 GN=zgc:66339 PE=1 SV=1
6	Q8N126	3.15e-19	90.9	398	0.155	0.153	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
7	Q9BY67	1.00e-18	89.7	442	0.140	0.124	CADM1_HUMAN Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1 PE=1 SV=2
8	Q6AYP5	1.64e-18	89.4	476	0.140	0.116	CADM1_RAT Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=1 SV=1
9	Q8R5M8	1.74e-18	89.0	456	0.140	0.121	CADM1_MOUSE Cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Cadm1 PE=1 SV=2
10	B0CLV6	4.04e-17	84.7	420	0.120	0.112	B0CLV6_DANRE Cell adhesion molecule 3 OS=Danio rerio OX=7955 GN=zgc:136589 PE=1 SV=1
11	Q1WIM2	6.68e-17	84.3	435	0.158	0.143	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
12	Q8BLQ9	6.99e-17	84.0	435	0.158	0.143	CADM2_MOUSE Cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Cadm2 PE=1 SV=2
13	Q8N3J6	7.74e-17	84.0	435	0.158	0.143	CADM2_HUMAN Cell adhesion molecule 2 OS=Homo sapiens OX=9606 GN=CADM2 PE=2 SV=1
14	Q8NFZ8	4.44e-11	66.2	388	0.102	0.103	CADM4_HUMAN Cell adhesion molecule 4 OS=Homo sapiens OX=9606 GN=CADM4 PE=1 SV=1
15	Q8R464	6.85e-11	65.5	388	0.102	0.103	CADM4_MOUSE Cell adhesion molecule 4 OS=Mus musculus OX=10090 GN=Cadm4 PE=1 SV=1
16	B0CLV3	2.21e-09	61.2	413	0.137	0.131	B0CLV3_DANRE Cell adhesion molecule 4 OS=Danio rerio OX=7955 GN=zgc:101704 PE=1 SV=1
17	Q5U3R8	5.29e-08	56.6	389	0.135	0.136	Q5U3R8_DANRE Cadm4 protein OS=Danio rerio OX=7955 GN=zgc:101704 PE=2 SV=1
18	Q8BLK3	1.59e-07	55.1	341	0.109	0.126	LSAMP_MOUSE Limbic system-associated membrane protein OS=Mus musculus OX=10090 GN=Lsamp PE=1 SV=1
19	H3BLU2	1.70e-07	55.1	345	0.117	0.133	H3BLU2_HUMAN Limbic system associated membrane protein (Fragment) OS=Homo sapiens OX=9606 GN=LSAMP PE=1 SV=1
20	Q96J84	2.11e-07	55.5	757	0.130	0.067	KIRR1_HUMAN Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606 GN=KIRREL1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	4	18.6	Adenovirus E3 region protein CR1
2	PF08205 C2-set_2	3.1e-07	41.7	CD80-like C2-set immunoglobulin domain
3	PF16118 DUF4834	34	16.8	Domain of unknown function (DUF4834)
4	PF17231 DUF5305	0.88	20.6	Family of unknown function (DUF5305)
5	PF19904 DUF6377	2.8e+02	12.5	Domain of unknown function (DUF6377)
6	PF07679 I-set	2.4e-05	35.6	Immunoglobulin I-set domain
7	PF00047 ig	3.5e-06	38.4	Immunoglobulin domain
8	PF13895 Ig_2	0.0006	31.4	Immunoglobulin domain
9	PF13927 Ig_3	1.1e-08	46.8	Immunoglobulin domain
10	PF16706 Izumo-Ig	4.5	18.6	Izumo-like Immunoglobulin domain
11	PF06024 Orf78	90	14.8	Orf78 (ac78)
12	PF13800 Sigma_reg_N	1.2e+02	14.4	Sigma factor regulator N-terminal
13	PF07686 V-set	1.6e-05	36.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000227348

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329797	0.954	Cell adhesion molecule 1
2	9606.ENSP00000252483	0.871	Nectin-2
3	9606.ENSP00000349486	0.758	Protein scribble homolog
4	9606.ENSP00000366307	0.720	Thrombomodulin
5	9606.ENSP00000264170	0.713	Kynureninase
6	9606.ENSP00000285670	0.712	SAM domain-containing protein SAMSN-1
7	9606.ENSP00000398655	0.710	Tyrosine-protein kinase ITK/TSK
8	9606.ENSP00000280200	0.678	CD226 antigen
9	9606.ENSP00000283285	0.661	T-cell surface protein tactile
10	9606.ENSP00000291890	0.567	Natural cytotoxicity triggering receptor 1
11	9606.ENSP00000306157	0.562	Interleukin-7 receptor subunit alpha
12	9606.ENSP00000216223	0.560	Interleukin-2 receptor subunit beta
13	9606.ENSP00000264010	0.558	Transcriptional repressor CTCF
14	9606.ENSP00000485010	0.557	MHC class II transactivator
15	9606.ENSP00000310405	0.552	Chemokine XC receptor 1
16	9606.ENSP00000357022	0.551	SLAM family member 7
17	9606.ENSP00000419085	0.551	T-cell immunoreceptor with Ig and ITIM domains
18	9606.ENSP00000263285	0.544	T-lymphocyte surface antigen Ly-9
19	9606.ENSP00000356792	0.539	Lymphotactin
20	9606.ENSP00000046794	0.535	Lymphocyte cytosolic protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0050794	0.999	regulation of cellular process
GO:0048518	0.998	positive regulation of biological process
GO:0009987	0.995	cellular process
GO:0048522	0.989	positive regulation of cellular process
GO:0002682	0.985	regulation of immune system process
GO:0048583	0.975	regulation of response to stimulus
GO:0048584	0.965	positive regulation of response to stimulus
GO:0050778	0.962	positive regulation of immune response
GO:0080134	0.961	regulation of response to stress
GO:0032101	0.960	regulation of response to external stimulus
GO:0060255	0.958	regulation of macromolecule metabolic process
GO:0031347	0.949	regulation of defense response
GO:0051239	0.943	regulation of multicellular organismal process
GO:0032103	0.943	positive regulation of response to external stimulus
GO:0002708	0.943	positive regulation of lymphocyte mediated immunity
GO:0031349	0.938	positive regulation of defense response
GO:0002831	0.935	regulation of response to biotic stimulus
GO:0045954	0.928	positive regulation of natural killer cell mediated cytotoxicity
GO:0010468	0.926	regulation of gene expression
GO:0001817	0.921	regulation of cytokine production
GO:0010604	0.893	positive regulation of macromolecule metabolic process
GO:0051240	0.892	positive regulation of multicellular organismal process
GO:0001819	0.877	positive regulation of cytokine production
GO:0008037	0.875	cell recognition
GO:0009607	0.650	response to biotic stimulus
GO:0009595	0.611	detection of biotic stimulus
GO:0002376	0.443	immune system process
GO:0032501	0.389	multicellular organismal process
GO:0048519	0.378	negative regulation of biological process
GO:0048523	0.368	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]