StarFunc result for job id O95744

User Input

>input (297 residues)
MGESSRKPPTPTPEGPTVSVKQLFSTLPVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSP
AMLPVQPAKLTEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKKIVGNSLDAGATNIDLKL
KDYGMDLIEVSGNGCGVEEENFEGLSLSALKHHTSKIREFADLTRVETFGFQGKALSSLC
ALSDVTISTCHVSAKVGTRLVFDHDGKIIKKTPYPHPRGTTVSVKQLFSTLPVRHKEFQR
NIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKLTVTGELRACRSWKTREGITEAVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54278	0.559	0.198	1.342E-26	862	0.522	0.180	P54278.pdb.gz	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
2	AFDB:P54279	0.559	0.199	1.857E-25	859	0.485	0.168	P54279.pdb.gz	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
3	AFDB:B1H246	0.561	0.201	3.530E-25	853	0.502	0.175	B1H246.pdb.gz	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
4	AFDB:F1NQJ3	0.567	0.199	1.352E-24	869	0.458	0.157	F1NQJ3.pdb.gz	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
5	AFDB:Q941I6	0.555	0.184	2.400E-19	923	0.303	0.098	Q941I6.pdb.gz	PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana OX=3702 GN=PMS1 PE=1 SV=1
6	AFDB:G5EFG5	0.550	0.208	9.744E-19	805	0.236	0.087	G5EFG5.pdb.gz	G5EFG5_CAEEL Mismatch repair endonuclease PMS2 OS=Caenorhabditis elegans OX=6239 GN=pms-2 PE=1 SV=1
7	AFDB:P54280	0.543	0.208	7.521E-18	794	0.269	0.101	P54280.pdb.gz	PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pms1 PE=3 SV=1
8	AFDB:Q8K119	0.507	0.170	2.881E-17	917	0.205	0.067	Q8K119.pdb.gz	Q8K119_MOUSE PMS1 homolog 1, mismatch repair system component OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
9	AFDB:P14242	0.544	0.190	4.872E-17	873	0.266	0.090	P14242.pdb.gz	PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMS1 PE=1 SV=3
10	AFDB:P54277	0.521	0.172	1.477E-16	932	0.212	0.068	P54277.pdb.gz	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
11	PDB:7p8vA	0.488	0.441	2.136E-13	331	0.192	0.172	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
12	PDB:5tthA	0.395	0.192	5.896E-7	671	0.101	0.045	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
13	PDB:7kclB	0.386	0.205	2.130E-6	614	0.094	0.046	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
14	PDB:5fwkA	0.380	0.195	5.422E-6	638	0.077	0.036	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
15	PDB:5tthB	0.396	0.208	7.260E-6	621	0.114	0.055	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
16	PDB:2cg9B	0.378	0.195	2.334E-5	618	0.077	0.037	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
17	PDB:6zy7B	0.352	0.107	2.948E-5	1160	0.094	0.024	6zy7B.pdb.gz	Structural basis for allosteric regulation of Human Topoisomerase II alpha.
18	PDB:6rkwD	0.372	0.162	6.677E-5	781	0.098	0.037	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
19	PDB:2zbkB	0.318	0.199	7.078E-5	506	0.094	0.055	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
20	PDB:1y4uB	0.264	0.181	8.940E-5	454	0.084	0.055	1y4uB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54278	5.22e-101	316	862	0.522	0.180	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
2	A0A8I5ZND0	2.61e-97	296	461	0.502	0.323	A0A8I5ZND0_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=1
3	D4A360	1.42e-93	295	800	0.502	0.186	D4A360_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=2
4	B1H246	2.17e-93	296	853	0.502	0.175	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
5	A0A0G2JW47	5.10e-93	296	882	0.502	0.169	A0A0G2JW47_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=1
6	P54279	2.69e-92	293	859	0.488	0.169	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
7	F1NQJ3	1.51e-85	276	869	0.458	0.157	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
8	Q941I6	1.76e-52	186	923	0.303	0.098	PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana OX=3702 GN=PMS1 PE=1 SV=1
9	P54280	3.51e-44	162	794	0.273	0.102	PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pms1 PE=3 SV=1
10	P14242	6.77e-39	147	873	0.263	0.089	PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMS1 PE=1 SV=3
11	G5EFG5	1.93e-38	145	805	0.236	0.087	G5EFG5_CAEEL Mismatch repair endonuclease PMS2 OS=Caenorhabditis elegans OX=6239 GN=pms-2 PE=1 SV=1
12	C9J167	1.14e-30	123	756	0.192	0.075	C9J167_HUMAN PMS1 homolog 2, mismatch repair system component OS=Homo sapiens OX=9606 GN=PMS2 PE=3 SV=2
13	P54277	2.06e-29	120	932	0.219	0.070	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
14	D4A651	3.37e-28	116	919	0.199	0.064	D4A651_RAT PMS1 homolog 1, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms1 PE=3 SV=3
15	Q6P7D0	3.96e-28	116	919	0.199	0.064	Q6P7D0_RAT PMS1 postmeiotic segregation increased 1 (S. cerevisiae) OS=Rattus norvegicus OX=10116 GN=Pms1 PE=2 SV=1
16	A0A8I6AGZ9	4.14e-28	116	880	0.199	0.067	A0A8I6AGZ9_RAT PMS1 homolog 1, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms1 PE=3 SV=1
17	Q3US89	6.25e-28	115	669	0.212	0.094	Q3US89_MOUSE HMG box domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=2 SV=1
18	E9Q8A5	6.37e-28	115	669	0.212	0.094	E9Q8A5_MOUSE PMS1 homolog 1, mismatch repair system component (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
19	Q8K119	7.84e-28	115	917	0.212	0.069	Q8K119_MOUSE PMS1 homolog 1, mismatch repair system component OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
20	P23367	5.38e-23	100	615	0.182	0.088	MUTL_ECOLI DNA mismatch repair protein MutL OS=Escherichia coli (strain K12) OX=83333 GN=mutL PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13589 HATPase_c_3	0.00053	31.4	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
2	PF18387 zf_C2H2_ZHX	9e+02	11.0	Zinc-fingers and homeoboxes C2H2 finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000020291

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000022032	0.954	DNA mismatch repair protein
2	9593.ENSGGOP00000018924	0.950	MutS homolog 6
3	9593.ENSGGOP00000027966	0.877	Component of the post-replicative DNA mismatch repair system (MMR)
4	9593.ENSGGOP00000015949	0.864	mutL homolog 1
5	9593.ENSGGOP00000013234	0.862	Exonuclease 1
6	9593.ENSGGOP00000011057	0.787	DNA mismatch repair protein
7	9593.ENSGGOP00000001670	0.636	Proliferating cell nuclear antigen
8	9593.ENSGGOP00000017490	0.636	Proliferating cell nuclear antigen
9	9593.ENSGGOP00000018939	0.605	Polymerase (DNA directed), delta 1, catalytic subunit
10	9593.ENSGGOP00000009561	0.592	Cellular tumor antigen p53
11	9593.ENSGGOP00000008668	0.589	BRCA1 interacting protein C-terminal helicase 1
12	9593.ENSGGOP00000013754	0.567	ERCC excision repair 5, endonuclease
13	9593.ENSGGOP00000014730	0.536	Replication protein A subunit
14	9593.ENSGGOP00000009612	0.535	E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule [...]
15	9593.ENSGGOP00000001911	0.526	Nuclease required for the repair of DNA interstrand cross- links (ICL). Acts as a 5'-3' exonuclease that anchors at a cut end of DNA and cleaves DNA successively at every third nucleotide, allowing to excise an ICL from one strand through flanking incisions.
16	9593.ENSGGOP00000012253	0.523	Flap endonuclease 1
17	9593.ENSGGOP00000027062	0.523	Flap endonuclease 1
18	9593.ENSGGOP00000017047	0.515	PMS1 homolog 1, mismatch repair system component
19	9593.ENSGGOP00000021616	0.512	F-box protein, helicase, 18
20	9593.ENSGGOP00000011864	0.508	GEN1 Holliday junction 5' flap endonuclease

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003677	0.997	DNA binding
GO:0003824	0.728	catalytic activity
GO:0016787	0.624	hydrolase activity
GO:0003690	0.579	double-stranded DNA binding
GO:0030983	0.476	mismatched DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0009987	0.969	cellular process
GO:0006950	0.930	response to stress
GO:0008152	0.864	metabolic process
GO:0051716	0.860	cellular response to stimulus
GO:0071704	0.828	organic substance metabolic process
GO:0033554	0.803	cellular response to stress
GO:0044238	0.786	primary metabolic process
GO:0044237	0.736	cellular metabolic process
GO:0006807	0.732	nitrogen compound metabolic process
GO:0043170	0.730	macromolecule metabolic process
GO:0046483	0.704	heterocycle metabolic process
GO:1901360	0.590	organic cyclic compound metabolic process
GO:0034641	0.564	cellular nitrogen compound metabolic process
GO:0090304	0.547	nucleic acid metabolic process
GO:0006259	0.542	DNA metabolic process
GO:0006974	0.541	cellular response to DNA damage stimulus
GO:0065007	0.467	biological regulation
GO:0006281	0.461	DNA repair
GO:0032501	0.440	multicellular organismal process
GO:0032502	0.422	developmental process
GO:0050789	0.393	regulation of biological process
GO:0071840	0.317	cellular component organization or biogenesis
GO:0016043	0.314	cellular component organization
GO:0050794	0.313	regulation of cellular process
GO:0048856	0.307	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0031981	0.993	nuclear lumen
GO:0005654	0.969	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.624	Hydrolases.

[back to server]