StarFunc result for job id O95747

User Input

>input (527 residues)
MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDEL
LKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDE
STIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRN
KVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTL
QNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEFL
QEKTLQRAPTISERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGKAAISQLRSP
RVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA
LSSGSGSQETKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLV
IVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95747	1.000	1.000	1.651E-95	527	1.000	1.000	O95747.pdb.gz	OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1
2	AFDB:Q9Z1W9	0.703	0.669	5.531E-74	556	0.740	0.701	Q9Z1W9.pdb.gz	STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus OX=10090 GN=Stk39 PE=1 SV=1
3	AFDB:Q7KSD3	0.660	0.632	2.698E-62	552	0.556	0.531	Q7KSD3.pdb.gz	Q7KSD3_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=fray PE=1 SV=1
4	AFDB:G5EEN4	0.619	0.551	1.292E-58	596	0.533	0.471	G5EEN4.pdb.gz	GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans OX=6239 GN=gck-3 PE=1 SV=1
5	AFDB:Q84WU5	0.547	0.432	8.369E-34	674	0.334	0.261	Q84WU5.pdb.gz	Q84WU5_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g14720 PE=1 SV=1
6	AFDB:F4JMF4	0.542	0.405	1.127E-31	711	0.311	0.231	F4JMF4.pdb.gz	F4JMF4_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g10730 PE=1 SV=1
7	AFDB:O61122	0.507	0.554	9.399E-30	478	0.302	0.333	O61122.pdb.gz	SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum OX=44689 GN=svkA PE=1 SV=1
8	AFDB:O23304	0.532	0.574	1.227E-29	487	0.283	0.306	O23304.pdb.gz	BLUS1_ARATH Serine/threonine-protein kinase BLUS1 OS=Arabidopsis thaliana OX=3702 GN=BLUS1 PE=1 SV=1
9	AFDB:Q54XL6	0.529	0.487	1.601E-29	574	0.287	0.263	Q54XL6.pdb.gz	FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum OX=44689 GN=fray1 PE=3 SV=1
10	AFDB:H2L099	0.501	0.410	3.757E-29	653	0.311	0.251	H2L099.pdb.gz	GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans OX=6239 GN=gck-1 PE=1 SV=1
11	PDB:3eqdA	0.447	0.728	1.818E-19	315	0.154	0.257	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
12	PDB:4eomC	0.427	0.772	1.957E-16	276	0.146	0.279	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
13	PDB:6s73A	0.435	0.827	6.321E-16	269	0.142	0.279	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
14	PDB:8bfsA	0.407	0.736	7.032E-16	274	0.152	0.292	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
15	PDB:5eymA	0.408	0.711	1.136E-15	292	0.148	0.267	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
16	PDB:8a8mB	0.410	0.694	1.264E-15	298	0.169	0.299	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
17	PDB:2h8hA	0.440	0.514	1.650E-15	445	0.144	0.171	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:1unlA	0.421	0.730	1.740E-15	292	0.129	0.233	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:2yaaA	0.442	0.745	2.271E-15	300	0.140	0.247	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
20	PDB:4mk0A	0.440	0.372	2.527E-15	631	0.148	0.124	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JIG9	0.0	951	468	0.871	0.981	C9JIG9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1
2	O88506	0.0	787	553	0.734	0.700	STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus OX=10116 GN=Stk39 PE=1 SV=2
3	O95747	0.0	1084	527	1.000	1.000	OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1
4	Q6P9R2	0.0	1014	527	0.958	0.958	OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus OX=10090 GN=Oxsr1 PE=1 SV=1
5	Q7KSD3	0.0	598	552	0.562	0.536	Q7KSD3_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=fray PE=1 SV=1
6	Q9UEW8	0.0	792	545	0.740	0.716	STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens OX=9606 GN=STK39 PE=1 SV=3
7	Q9VE62	0.0	600	552	0.564	0.538	Q9VE62_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=fray PE=2 SV=3
8	Q9Z1W9	0.0	793	556	0.740	0.701	STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus OX=10090 GN=Stk39 PE=1 SV=1
9	G5EEN4	5.56e-153	452	596	0.412	0.364	GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans OX=6239 GN=gck-3 PE=1 SV=1
10	Q84WU5	6.96e-106	333	674	0.300	0.234	Q84WU5_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g14720 PE=1 SV=1
11	F4JMF4	3.42e-97	311	711	0.279	0.207	F4JMF4_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g10730 PE=1 SV=1
12	O61122	3.95e-76	249	478	0.262	0.289	SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum OX=44689 GN=svkA PE=1 SV=1
13	Q54XL6	4.81e-75	249	574	0.247	0.226	FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum OX=44689 GN=fray1 PE=3 SV=1
14	Q7ZVG8	9.76e-74	242	424	0.258	0.321	Q7ZVG8_DANRE Serine/threonine kinase 25 (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk25 PE=2 SV=1
15	Q8IGS1	2.99e-73	246	642	0.250	0.206	Q8IGS1_DROME RE38276p OS=Drosophila melanogaster OX=7227 GN=GckIII PE=2 SV=1
16	Q9VEN3	3.53e-73	246	642	0.250	0.206	Q9VEN3_DROME FI20177p1 OS=Drosophila melanogaster OX=7227 GN=GckIII PE=1 SV=1
17	H2L099	8.86e-73	245	653	0.241	0.194	GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans OX=6239 GN=gck-1 PE=1 SV=1
18	F8W562	9.08e-73	239	421	0.254	0.318	F8W562_DANRE Serine/threonine kinase 25a OS=Danio rerio OX=7955 GN=zgc:92836 PE=4 SV=1
19	Q6V9V9	4.54e-72	238	426	0.252	0.312	Q6V9V9_RAT Serine/threonine kinase 25 OS=Rattus norvegicus OX=10116 GN=Stk25 PE=1 SV=1
20	Q9Z2W1	4.54e-72	238	426	0.252	0.312	STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus OX=10090 GN=Stk25 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.031	24.9	ABC1 atypical kinase-like domain
2	PF14531 Kinase-like	26	15.6	Kinase-like
3	PF12202 OSR1_C	7.3e-20	82.1	Oxidative-stress-responsive kinase 1 C-terminal domain
4	PF00069 Pkinase	7e-60	214.2	Protein kinase domain
5	PF17667 Pkinase_fungal	0.098	23.0	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	4.5e-44	162.3	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311713

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297164	0.950	Induces activation of MAPK14/p38 cascade, when overexpressed . Induces apoptosis, when overexpressed
2	9606.ENSP00000064780	0.938	Tumor necrosis factor receptor superfamily member 19L
3	9606.ENSP00000262461	0.893	Solute carrier family 12 member 2
4	9606.ENSP00000246914	0.886	Serine/threonine-protein kinase WNK4
5	9606.ENSP00000398778	0.884	RELT-like protein 1
6	9606.ENSP00000341292	0.876	Serine/threonine-protein kinase WNK1
7	9606.ENSP00000379822	0.840	Solute carrier family 12 member 1
8	9606.ENSP00000310241	0.820	Solute carrier family 22 member 13
9	9606.ENSP00000258418	0.805	Calcium-binding protein 39
10	9606.ENSP00000207870	0.768	Xylulose kinase
11	9606.ENSP00000273173	0.768	Solute carrier family 22 member 14
12	9606.ENSP00000346667	0.762	Serine/threonine-protein kinase WNK3
13	9606.ENSP00000297954	0.741	Serine/threonine-protein kinase WNK2
14	9606.ENSP00000338624	0.726	Threonine aspartase 1
15	9606.ENSP00000408526	0.703	Inositol monophosphatase 1
16	9606.ENSP00000346112	0.677	Solute carrier family 12 member 6
17	9606.ENSP00000402152	0.661	Solute carrier family 12 member 3
18	9606.ENSP00000329933	0.655	PHD finger protein 12
19	9606.ENSP00000376432	0.628	ATP-sensitive inward rectifier potassium channel 1
20	9606.ENSP00000387694	0.627	Solute carrier family 12 member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0019900	0.953	kinase binding
GO:0019901	0.936	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0065007	0.985	biological regulation
GO:0050794	0.982	regulation of cellular process
GO:0006468	0.975	protein phosphorylation
GO:0032101	0.974	regulation of response to external stimulus
GO:0104004	0.971	cellular response to environmental stimulus
GO:2000401	0.969	regulation of lymphocyte migration
GO:1990868	0.965	response to chemokine
GO:0071470	0.959	cellular response to osmotic stress
GO:2000404	0.956	regulation of T cell migration
GO:0071677	0.956	positive regulation of mononuclear cell migration
GO:0002688	0.948	regulation of leukocyte chemotaxis
GO:1990869	0.933	cellular response to chemokine
GO:0018210	0.923	peptidyl-threonine modification
GO:0050921	0.922	positive regulation of chemotaxis
GO:0002690	0.906	positive regulation of leukocyte chemotaxis
GO:0034765	0.853	regulation of monoatomic ion transmembrane transport
GO:0023052	0.851	signaling
GO:2000403	0.841	positive regulation of lymphocyte migration
GO:0010959	0.839	regulation of metal ion transport
GO:1904062	0.839	regulation of monoatomic cation transmembrane transport
GO:0032412	0.839	regulation of monoatomic ion transmembrane transporter activity
GO:0007154	0.820	cell communication
GO:0006971	0.809	hypotonic response
GO:0007165	0.794	signal transduction
GO:0018107	0.787	peptidyl-threonine phosphorylation
GO:0032413	0.787	negative regulation of ion transmembrane transporter activity
GO:0043266	0.785	regulation of potassium ion transport
GO:1901379	0.780	regulation of potassium ion transmembrane transport
GO:1904063	0.765	negative regulation of cation transmembrane transport
GO:0043267	0.761	negative regulation of potassium ion transport
GO:0035556	0.653	intracellular signal transduction
GO:0046777	0.616	protein autophosphorylation
GO:0051179	0.395	localization
GO:0019221	0.391	cytokine-mediated signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.992	cytosol
GO:0043227	0.926	membrane-bounded organelle
GO:0016020	0.713	membrane
GO:0031982	0.612	vesicle
GO:0043229	0.607	intracellular organelle
GO:0043231	0.486	intracellular membrane-bounded organelle
GO:0043230	0.425	extracellular organelle
GO:1903561	0.420	extracellular vesicle
GO:0070062	0.412	extracellular exosome
GO:0071944	0.358	cell periphery
GO:0005886	0.315	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]