StarFunc result for job id O95750

User Input

>input (216 residues)
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95750	1.000	1.000	9.652E-43	216	1.000	1.000	O95750.pdb.gz	FGF19_HUMAN Fibroblast growth factor 19 OS=Homo sapiens OX=9606 GN=FGF19 PE=1 SV=1
2	AFDB:O35622	0.577	0.572	3.848E-21	218	0.514	0.509	O35622.pdb.gz	FGF15_MOUSE Fibroblast growth factor 15 OS=Mus musculus OX=10090 GN=Fgf15 PE=1 SV=1
3	AFDB:E1BDA6	0.580	0.598	1.303E-17	209	0.333	0.344	E1BDA6.pdb.gz	E1BDA6_BOVIN Fibroblast growth factor OS=Bos taurus OX=9913 GN=FGF21 PE=3 SV=1
4	AFDB:Q9JJN1	0.570	0.585	1.945E-17	210	0.338	0.348	Q9JJN1.pdb.gz	FGF21_MOUSE Fibroblast growth factor 21 OS=Mus musculus OX=10090 GN=Fgf21 PE=1 SV=1
5	AFDB:Q5TLF0	0.596	0.611	2.309E-17	210	0.384	0.395	Q5TLF0.pdb.gz
6	AFDB:Q9NSA1	0.568	0.586	3.074E-17	209	0.333	0.344	Q9NSA1.pdb.gz	FGF21_HUMAN Fibroblast growth factor 21 OS=Homo sapiens OX=9606 GN=FGF21 PE=1 SV=1
7	AFDB:A0A0R4IU37	0.516	0.571	3.764E-15	194	0.282	0.314	A0A0R4IU37.pdb.gz
8	AFDB:Q8VI82	0.597	0.524	8.389E-15	251	0.278	0.239	Q8VI82.pdb.gz	FGF23_RAT Fibroblast growth factor 23 OS=Rattus norvegicus OX=10116 GN=Fgf23 PE=2 SV=1
9	AFDB:Q9GZV9	0.572	0.500	8.883E-15	251	0.292	0.251	Q9GZV9.pdb.gz	FGF23_HUMAN Fibroblast growth factor 23 OS=Homo sapiens OX=9606 GN=FGF23 PE=1 SV=1
10	AFDB:Q1L8M3	0.568	0.482	1.645E-13	258	0.269	0.225	Q1L8M3.pdb.gz
11	PDB:4jq0A	0.405	0.602	1.101E-7	141	0.153	0.234	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
12	PDB:3f1rA	0.467	0.627	1.553E-7	157	0.204	0.280	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
13	PDB:1ry7A	0.500	0.697	2.067E-7	151	0.208	0.298	1ry7A.pdb.gz
14	PDB:6b0tA	0.444	0.209	3.729E-4	487	0.111	0.049	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:7ua3A	0.396	0.024	3.680E-3	4443	0.097	0.005	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
16	PDB:7t3qA	0.391	0.049	6.160E-3	2103	0.088	0.009	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:7m6aA	0.378	0.025	7.314E-3	4306	0.111	0.006	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
18	PDB:7t3uA	0.365	0.047	1.031E-2	2020	0.083	0.009	7t3uA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:7t3pA	0.309	0.040	1.156E-2	2066	0.102	0.011	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:7t3rA	0.294	0.040	1.373E-2	2130	0.111	0.011	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95750	1.93e-160	443	216	1.000	1.000	FGF19_HUMAN Fibroblast growth factor 19 OS=Homo sapiens OX=9606 GN=FGF19 PE=1 SV=1
2	Q8VI81	2.25e-67	208	218	0.532	0.528	Q8VI81_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf19 PE=2 SV=1
3	O35622	8.79e-66	204	218	0.519	0.514	FGF15_MOUSE Fibroblast growth factor 15 OS=Mus musculus OX=10090 GN=Fgf15 PE=1 SV=1
4	A0A0R4IN60	2.91e-39	136	209	0.417	0.431	A0A0R4IN60_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf19 PE=3 SV=1
5	Q8VI80	3.00e-26	102	208	0.352	0.365	Q8VI80_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf21 PE=3 SV=1
6	Q9JJN1	9.27e-25	98.6	210	0.347	0.357	FGF21_MOUSE Fibroblast growth factor 21 OS=Mus musculus OX=10090 GN=Fgf21 PE=1 SV=1
7	Q9NSA1	6.21e-22	91.3	209	0.264	0.273	FGF21_HUMAN Fibroblast growth factor 21 OS=Homo sapiens OX=9606 GN=FGF21 PE=1 SV=1
8	F7FG05	6.29e-22	91.3	219	0.287	0.283	F7FG05_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf21 PE=3 SV=1
9	E1BDA6	2.02e-21	89.7	209	0.255	0.263	E1BDA6_BOVIN Fibroblast growth factor OS=Bos taurus OX=9913 GN=FGF21 PE=3 SV=1
10	Q9EPC2	8.50e-18	81.3	251	0.269	0.231	FGF23_MOUSE Fibroblast growth factor 23 OS=Mus musculus OX=10090 GN=Fgf23 PE=1 SV=1
11	Q1XG76	2.91e-16	76.3	207	0.269	0.280	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
12	Q1ESX2	3.56e-16	75.5	194	0.273	0.304	Q1ESX2_DANRE Fibroblast growth factor 21 OS=Danio rerio OX=7955 GN=fgf21 PE=2 SV=1
13	Q9GZV9	1.12e-15	75.5	251	0.255	0.219	FGF23_HUMAN Fibroblast growth factor 23 OS=Homo sapiens OX=9606 GN=FGF23 PE=1 SV=1
14	Q8VI82	1.24e-15	75.1	251	0.250	0.215	FGF23_RAT Fibroblast growth factor 23 OS=Rattus norvegicus OX=10116 GN=Fgf23 PE=2 SV=1
15	B3DGE3	3.21e-14	69.3	154	0.171	0.240	B3DGE3_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf2 PE=2 SV=1
16	A0A060Y7E5	9.55e-14	68.2	155	0.194	0.271	A0A060Y7E5_ONCMY Fibroblast growth factor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000746001 PE=3 SV=1
17	Q5FXK5	1.95e-13	67.4	155	0.194	0.271	Q5FXK5_ONCMY Fibroblast growth factor OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
18	Q5MK87	2.64e-13	68.9	258	0.218	0.182	Q5MK87_DANRE Fgf23 OS=Danio rerio OX=7955 GN=fgf23 PE=2 SV=1
19	P12226	5.55e-13	66.2	155	0.162	0.226	FGF2_XENLA Fibroblast growth factor 2 OS=Xenopus laevis OX=8355 GN=fgf2 PE=2 SV=2
20	Q9ESS2	2.01e-12	64.7	162	0.241	0.321	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	1.8e-16	71.7	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294312

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257408	0.999	Beta-klotho
2	9606.ENSP00000292408	0.999	Fibroblast growth factor receptor 4
3	9606.ENSP00000339824	0.972	Fibroblast growth factor receptor 3
4	9606.ENSP00000410294	0.970	Fibroblast growth factor receptor 2
5	9606.ENSP00000393312	0.964	Fibroblast growth factor receptor 1
6	9606.ENSP00000369442	0.963	Klotho
7	9606.ENSP00000263025	0.941	Mitogen-activated protein kinase 3
8	9606.ENSP00000407586	0.938	GTPase HRas
9	9606.ENSP00000256078	0.926	GTPase KRas
10	9606.ENSP00000480132	0.914	Neural cell adhesion molecule 1
11	9606.ENSP00000215832	0.913	Mitogen-activated protein kinase 1
12	9606.ENSP00000370542	0.911	Syndecan-1
13	9606.ENSP00000358548	0.908	GTPase NRas
14	9606.ENSP00000307046	0.906	Syndecan-2
15	9606.ENSP00000447149	0.906	Bile acid receptor
16	9606.ENSP00000344468	0.905	Syndecan-3
17	9606.ENSP00000447241	0.819	Fibroblast growth factor receptor substrate 2
18	9606.ENSP00000301645	0.807	Cholesterol 7-alpha-monooxygenase
19	9606.ENSP00000263923	0.804	Vascular endothelial growth factor receptor 2
20	9606.ENSP00000321797	0.802	Fibroblast growth factor 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005104	1.000	fibroblast growth factor receptor binding
GO:0098772	0.928	molecular function regulator activity
GO:0140677	0.921	molecular function activator activity
GO:0048018	0.882	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0019222	0.970	regulation of metabolic process
GO:0023052	0.968	signaling
GO:0008284	0.960	positive regulation of cell population proliferation
GO:0032502	0.945	developmental process
GO:0031323	0.933	regulation of cellular metabolic process
GO:0080090	0.931	regulation of primary metabolic process
GO:0048856	0.920	anatomical structure development
GO:0048583	0.917	regulation of response to stimulus
GO:0051716	0.908	cellular response to stimulus
GO:0007154	0.900	cell communication
GO:0043408	0.897	regulation of MAPK cascade
GO:0048519	0.882	negative regulation of biological process
GO:0007169	0.874	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0071363	0.872	cellular response to growth factor stimulus
GO:0032501	0.867	multicellular organismal process
GO:0019216	0.839	regulation of lipid metabolic process
GO:0060255	0.836	regulation of macromolecule metabolic process
GO:0051171	0.818	regulation of nitrogen compound metabolic process
GO:0008543	0.776	fibroblast growth factor receptor signaling pathway
GO:0007275	0.766	multicellular organism development
GO:0009893	0.758	positive regulation of metabolic process
GO:0032879	0.748	regulation of localization
GO:0051049	0.742	regulation of transport
GO:0009892	0.727	negative regulation of metabolic process
GO:0010604	0.720	positive regulation of macromolecule metabolic process
GO:0031325	0.710	positive regulation of cellular metabolic process
GO:0043410	0.708	positive regulation of MAPK cascade
GO:0048731	0.700	system development
GO:0051173	0.666	positive regulation of nitrogen compound metabolic process
GO:0062012	0.634	regulation of small molecule metabolic process
GO:0042325	0.624	regulation of phosphorylation
GO:0051246	0.603	regulation of protein metabolic process
GO:0009889	0.594	regulation of biosynthetic process
GO:0010562	0.521	positive regulation of phosphorus metabolic process
GO:0010827	0.508	regulation of glucose transmembrane transport
GO:0001934	0.496	positive regulation of protein phosphorylation
GO:0048523	0.486	negative regulation of cellular process
GO:0031326	0.440	regulation of cellular biosynthetic process
GO:0010468	0.438	regulation of gene expression
GO:0070372	0.405	regulation of ERK1 and ERK2 cascade
GO:0008152	0.390	metabolic process
GO:0042221	0.388	response to chemical
GO:0071704	0.342	organic substance metabolic process
GO:0080134	0.324	regulation of response to stress
GO:0051239	0.323	regulation of multicellular organismal process
GO:0044237	0.322	cellular metabolic process
GO:0046324	0.309	regulation of glucose import
GO:0051050	0.306	positive regulation of transport
GO:0070887	0.301	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005622	0.626	intracellular anatomical structure
GO:0005615	0.548	extracellular space
GO:0005737	0.483	cytoplasm
GO:0071944	0.444	cell periphery
GO:0005886	0.433	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]