StarFunc result for job id O95751

User Input

>input (146 residues)
MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGE
SSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRA
FLDEMKQCFGWDDDEDDDDEEEEDDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95751	1.000	1.000	3.115E-23	146	1.000	1.000	O95751.pdb.gz	LDOC1_HUMAN Protein LDOC1 OS=Homo sapiens OX=9606 GN=LDOC1 PE=1 SV=1
2	AFDB:Q7TPY9	0.753	0.732	8.535E-18	151	0.712	0.689	Q7TPY9.pdb.gz	LDOC1_MOUSE Protein LDOC1 OS=Mus musculus OX=10090 GN=Ldoc1 PE=2 SV=1
3	AFDB:A6ZKI3	0.596	0.764	5.846E-12	113	0.425	0.549	A6ZKI3.pdb.gz	RTL8C_HUMAN Retrotransposon Gag-like protein 8C OS=Homo sapiens OX=9606 GN=RTL8C PE=1 SV=1
4	AFDB:A0A087WX23	0.518	0.105	7.697E-7	783	0.288	0.054	A0A087WX23.pdb.gz	A0A087WX23_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=1
5	AFDB:Q7TN75	0.534	0.087	4.256E-6	958	0.164	0.025	Q7TN75.pdb.gz	PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus OX=10090 GN=Peg10 PE=1 SV=2
6	AFDB:Q7M732	0.506	0.044	5.434E-6	1744	0.226	0.019	Q7M732.pdb.gz	RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus OX=10090 GN=Rtl1 PE=2 SV=1
7	AFDB:Q7L3V2	0.500	0.208	6.140E-6	364	0.192	0.077	Q7L3V2.pdb.gz	BOP_HUMAN Protein Bop OS=Homo sapiens OX=9606 GN=RTL10 PE=1 SV=1
8	AFDB:Q7JV70	0.413	0.318	1.948E-2	193	0.137	0.104	Q7JV70.pdb.gz	ARC2_DROME Activity-regulated cytoskeleton associated protein 2 OS=Drosophila melanogaster OX=7227 GN=Arc2 PE=1 SV=1
9	AFDB:Q9FZH9	0.438	0.102	3.814E-2	659	0.137	0.030	Q9FZH9.pdb.gz	Q9FZH9_ARATH F1O19.7 protein OS=Arabidopsis thaliana OX=3702 GN=At1g67020 PE=4 SV=1
10	AFDB:Q09PK2	0.407	0.188	4.581E-2	339	0.178	0.077	Q09PK2.pdb.gz	APRV1_MOUSE Retroviral-like aspartic protease 1 OS=Mus musculus OX=10090 GN=Asprv1 PE=1 SV=1
11	PDB:5n0cA	0.179	0.027	5.103	1293	0.048	0.005	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
12	PDB:3e6uA	0.151	0.079	6.129	409	0.130	0.046	3e6uA.pdb.gz	Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
13	PDB:3mxzA	0.155	0.191	7.361	107	0.082	0.112	3mxzA.pdb.gz
14	PDB:3qxyA	0.113	0.055	7.361	420	0.048	0.017	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
15	PDB:2fi7A	0.162	0.118	7.824	223	0.055	0.036	2fi7A.pdb.gz
16	PDB:4nrhB	0.184	0.161	7.824	170	0.041	0.035	4nrhB.pdb.gz
17	PDB:4pdeA	0.104	0.068	7.824	244	0.055	0.033	4pdeA.pdb.gz	Sulphur shuttling across a chaperone during molybdenum cofactor maturation.
18	PDB:5bycA	0.176	0.094	8.317	318	0.027	0.013	5bycA.pdb.gz
19	PDB:7yqcA	0.148	0.116	8.317	198	0.089	0.066	7yqcA.pdb.gz
20	PDB:3mhsA	0.176	0.076	8.841	455	0.116	0.037	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95751	3.16e-105	298	146	1.000	1.000	LDOC1_HUMAN Protein LDOC1 OS=Homo sapiens OX=9606 GN=LDOC1 PE=1 SV=1
2	Q7TPY9	1.86e-63	192	151	0.705	0.682	LDOC1_MOUSE Protein LDOC1 OS=Mus musculus OX=10090 GN=Ldoc1 PE=2 SV=1
3	Q17RB0	1.61e-42	138	113	0.432	0.558	RTL8B_HUMAN Retrotransposon Gag-like protein 8B OS=Homo sapiens OX=9606 GN=RTL8B PE=1 SV=1
4	Q9BWD3	5.26e-41	134	113	0.425	0.549	RTL8A_HUMAN Retrotransposon Gag-like protein 8A OS=Homo sapiens OX=9606 GN=RTL8A PE=1 SV=3
5	A6ZKI3	1.00e-40	134	113	0.418	0.540	RTL8C_HUMAN Retrotransposon Gag-like protein 8C OS=Homo sapiens OX=9606 GN=RTL8C PE=1 SV=1
6	A0A087WZG9	2.51e-10	59.3	359	0.288	0.117	A0A087WZG9_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
7	A0A087WXK2	7.26e-10	58.2	707	0.288	0.059	A0A087WXK2_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=1
8	Q86TG7	7.48e-10	58.2	708	0.288	0.059	PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
9	A0A087WUL4	8.12e-10	58.2	741	0.288	0.057	A0A087WUL4_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
10	A0A087WX23	9.18e-10	57.8	783	0.288	0.054	A0A087WX23_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=1
11	Q7L3V2	1.76e-06	48.1	364	0.158	0.063	BOP_HUMAN Protein Bop OS=Homo sapiens OX=9606 GN=RTL10 PE=1 SV=1
12	Q7TN75	2.18e-06	48.1	958	0.158	0.024	PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus OX=10090 GN=Peg10 PE=1 SV=2
13	Q7M732	1.08e-05	46.2	1744	0.164	0.014	RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus OX=10090 GN=Rtl1 PE=2 SV=1
14	Q6P0W1	3.6	29.6	246	0.089	0.053	Q6P0W1_DANRE Tetraspanin OS=Danio rerio OX=7955 GN=zgc:77598 PE=2 SV=1
15	Q8IVV2	4.1	29.6	2067	0.103	0.007	LOXH1_HUMAN Lipoxygenase homology domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LOXHD1 PE=2 SV=4
16	C8YR32	4.3	29.6	2068	0.103	0.007	LOXH1_MOUSE Lipoxygenase homology domain-containing protein 1 OS=Mus musculus OX=10090 GN=Loxhd1 PE=2 SV=1
17	Q5DTJ9	4.8	29.6	1315	0.089	0.010	MYPN_MOUSE Myopalladin OS=Mus musculus OX=10090 GN=Mypn PE=1 SV=2
18	A0A8I6AC84	5.7	29.3	4254	0.178	0.006	A0A8I6AC84_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=1
19	Q8I218	5.7	29.3	3467	0.082	0.003	Q8I218_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0400400 PE=4 SV=1
20	F1MAD3	5.8	29.3	4292	0.178	0.006	F1MAD3_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16297 DUF4939	2.6e-51	183.6	Domain of unknown function (DUF4939)
2	PF19259 Ty3_capsid	0.2	22.6	Ty3 transposon capsid-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359557

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418944	0.678	Retrotransposon-derived protein PEG10
2	9606.ENSP00000419786	0.650	Retrotransposon Gag-like protein 9
3	9606.ENSP00000272424	0.634	EKC/KEOPS complex subunit TPRKB
4	9606.ENSP00000340590	0.603	Retrotransposon Gag-like protein 4
5	9606.ENSP00000282326	0.590	Zinc finger and SCAN domain-containing protein 1
6	9606.ENSP00000364935	0.588	Chloride intracellular channel protein 1
7	9606.ENSP00000338573	0.587	Guanine nucleotide-binding protein-like 3-like protein
8	9606.ENSP00000273550	0.582	Ferritin heavy chain
9	9606.ENSP00000388850	0.559	Paraneoplastic antigen-like protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0009987	0.985	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0051716	0.972	cellular response to stimulus
GO:0042221	0.965	response to chemical
GO:0048519	0.960	negative regulation of biological process
GO:0048523	0.951	negative regulation of cellular process
GO:0071310	0.919	cellular response to organic substance
GO:0009605	0.907	response to external stimulus
GO:1901701	0.882	cellular response to oxygen-containing compound
GO:1901698	0.870	response to nitrogen compound
GO:0042127	0.868	regulation of cell population proliferation
GO:0009719	0.839	response to endogenous stimulus
GO:0051707	0.829	response to other organism
GO:0071216	0.786	cellular response to biotic stimulus
GO:0071222	0.777	cellular response to lipopolysaccharide
GO:0010243	0.742	response to organonitrogen compound
GO:0071495	0.716	cellular response to endogenous stimulus
GO:1901652	0.715	response to peptide
GO:1901699	0.680	cellular response to nitrogen compound
GO:1901653	0.644	cellular response to peptide
GO:0008285	0.609	negative regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005730	0.989	nucleolus
GO:0005829	0.963	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]