StarFunc result for job id O95754

User Input

>input (770 residues)
MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVP
HTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKED
ECHNFVQILAIANASHLLTCGTFAFDPKCGVIDVSRFQQVERLESGRGKCPFEPAQRSAA
VMAGGVLYAATVKNYLGTEPIITRAVGRAEDWIRTDTLPSWLNAPAFVAAVALSPAEWGD
EDGDDEIYFFFTETSRAFDSYERIKVPRVARVCAGDLGGRKTLQQRWTTFLKADLLCPGP
EHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRE
LKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP
ADGHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLAL
FPEPQPVENMKLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECV
AHAGEHRGLVQDIESADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQ
PSGVTALTPRRDGLEVVVTPGAMGAYACECQEGGAAHVVAAYSLVWGSQRDAPSRAHTVG
AGLAGFFLGILAASLTLILIGRRQQRRRQRELLARDKVGLDLGAPPSGTTSYSQDPPSPS
PEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHIRLTGAPLATCDETSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z123	0.947	0.938	0.000	777	0.912	0.903	Q9Z123.pdb.gz	SEM4F_MOUSE Semaphorin-4F OS=Mus musculus OX=10090 GN=Sema4f PE=1 SV=2
2	AFDB:Q64151	0.779	0.722	1.011E-71	834	0.340	0.314	Q64151.pdb.gz	SEM4C_MOUSE Semaphorin-4C OS=Mus musculus OX=10090 GN=Sema4c PE=1 SV=1
3	AFDB:Q9C0C4	0.740	0.685	1.066E-71	833	0.339	0.313	Q9C0C4.pdb.gz	SEM4C_HUMAN Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2
4	AFDB:Q9NTN9	0.725	0.668	1.539E-70	838	0.326	0.300	Q9NTN9.pdb.gz	SEM4G_HUMAN Semaphorin-4G OS=Homo sapiens OX=9606 GN=SEMA4G PE=1 SV=1
5	AFDB:Q62179	0.710	0.666	1.593E-67	823	0.340	0.318	Q62179.pdb.gz	SEM4B_MOUSE Semaphorin-4B OS=Mus musculus OX=10090 GN=Sema4b PE=1 SV=2
6	AFDB:O09126	0.722	0.649	1.149E-66	861	0.309	0.276	O09126.pdb.gz	SEM4D_MOUSE Semaphorin-4D OS=Mus musculus OX=10090 GN=Sema4d PE=1 SV=2
7	AFDB:Q92854	0.716	0.643	1.340E-65	862	0.306	0.274	Q92854.pdb.gz	SEM4D_HUMAN Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D PE=1 SV=1
8	AFDB:Q62178	0.687	0.696	6.971E-64	760	0.288	0.292	Q62178.pdb.gz	SEM4A_MOUSE Semaphorin-4A OS=Mus musculus OX=10090 GN=Sema4a PE=1 SV=2
9	AFDB:Q9H3S1	0.701	0.709	1.013E-63	761	0.306	0.310	Q9H3S1.pdb.gz	SEM4A_HUMAN Semaphorin-4A OS=Homo sapiens OX=9606 GN=SEMA4A PE=1 SV=2
10	AFDB:Q13214	0.709	0.728	3.070E-61	749	0.296	0.304	Q13214.pdb.gz	SEM3B_HUMAN Semaphorin-3B OS=Homo sapiens OX=9606 GN=SEMA3B PE=1 SV=1
11	PDB:6qp7A	0.630	0.771	7.135E-47	620	0.213	0.265	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	PDB:3nvqA	0.627	0.806	2.108E-40	588	0.212	0.277	3nvqA.pdb.gz
13	PDB:3nvnA	0.437	0.839	4.133E-20	383	0.091	0.183	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
14	PDB:6vxkB	0.388	0.398	2.013E-16	747	0.142	0.146	6vxkB.pdb.gz
15	PDB:5y31B	0.274	0.386	3.242E-7	511	0.056	0.084	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
16	PDB:6n8sA	0.232	0.217	7.222E-7	834	0.084	0.078	6n8sA.pdb.gz
17	PDB:6bk8M	0.260	0.541	8.036E-7	326	0.057	0.135	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
18	PDB:7mq8LR	0.156	0.156	1.168E-6	773	0.066	0.066	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:6jp6A	0.183	0.150	2.744E-6	998	0.070	0.054	6jp6A.pdb.gz
20	PDB:7wb4c	0.297	0.590	2.744E-6	346	0.069	0.153	7wb4c.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95754	0.0	1567	770	1.000	1.000	SEM4F_HUMAN Semaphorin-4F OS=Homo sapiens OX=9606 GN=SEMA4F PE=2 SV=2
2	Q9Z123	0.0	1384	777	0.886	0.878	SEM4F_MOUSE Semaphorin-4F OS=Mus musculus OX=10090 GN=Sema4f PE=1 SV=2
3	Q9Z143	0.0	1381	776	0.887	0.880	SEM4F_RAT Semaphorin-4F OS=Rattus norvegicus OX=10116 GN=Sema4f PE=1 SV=1
4	Q64151	1.27e-128	405	834	0.318	0.294	SEM4C_MOUSE Semaphorin-4C OS=Mus musculus OX=10090 GN=Sema4c PE=1 SV=1
5	Q9C0C4	3.72e-128	404	833	0.308	0.285	SEM4C_HUMAN Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2
6	Q92854	1.13e-125	398	862	0.300	0.268	SEM4D_HUMAN Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D PE=1 SV=1
7	O09126	5.15e-125	396	861	0.294	0.262	SEM4D_MOUSE Semaphorin-4D OS=Mus musculus OX=10090 GN=Sema4d PE=1 SV=2
8	Q62179	8.19e-125	395	823	0.316	0.295	SEM4B_MOUSE Semaphorin-4B OS=Mus musculus OX=10090 GN=Sema4b PE=1 SV=2
9	Q9WUH7	5.85e-113	364	837	0.303	0.278	SEM4G_MOUSE Semaphorin-4G OS=Mus musculus OX=10090 GN=Sema4g PE=1 SV=1
10	Q9NTN9	8.29e-110	355	838	0.304	0.279	SEM4G_HUMAN Semaphorin-4G OS=Homo sapiens OX=9606 GN=SEMA4G PE=1 SV=1
11	Q9H3S1	1.52e-103	337	761	0.290	0.293	SEM4A_HUMAN Semaphorin-4A OS=Homo sapiens OX=9606 GN=SEMA4A PE=1 SV=2
12	Q62178	4.35e-101	330	760	0.288	0.292	SEM4A_MOUSE Semaphorin-4A OS=Mus musculus OX=10090 GN=Sema4a PE=1 SV=2
13	Q90663	4.94e-97	320	761	0.278	0.281	SEM3D_CHICK Semaphorin-3D OS=Gallus gallus OX=9031 GN=SEMA3D PE=2 SV=1
14	Q8BH34	9.12e-94	311	777	0.277	0.274	SEM3D_MOUSE Semaphorin-3D OS=Mus musculus OX=10090 GN=Sema3d PE=1 SV=1
15	Q13214	2.98e-88	296	749	0.273	0.280	SEM3B_HUMAN Semaphorin-3B OS=Homo sapiens OX=9606 GN=SEMA3B PE=1 SV=1
16	Q9W6G6	8.38e-85	287	764	0.270	0.272	SEM3D_DANRE Semaphorin-3D OS=Danio rerio OX=7955 GN=sema3d PE=2 SV=1
17	Q63548	5.81e-82	280	772	0.269	0.268	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
18	Q9W686	6.66e-82	280	778	0.256	0.253	SE3AB_DANRE Semaphorin-3ab OS=Danio rerio OX=7955 GN=sema3ab PE=2 SV=1
19	F1NVZ5	6.93e-82	280	808	0.257	0.245	F1NVZ5_CHICK Semaphorin 3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=3 SV=2
20	Q90607	7.43e-82	279	772	0.258	0.258	SEM3A_CHICK Semaphorin-3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04995 CcmD	4.2e+02	12.4	Heme exporter protein D (CcmD)
2	PF13570 PQQ_3	2.4e+02	13.7	PQQ-like domain
3	PF01437 PSI	0.0018	30.1	Plexin repeat
4	PF17205 PSI_integrin	5.4e+02	11.7	Integrin plexin domain
5	PF01403 Sema	2.2e-51	185.8	Sema domain
6	PF19428 Sema4F_C	3.8e-102	351.3	Semaphorin 4F C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350547

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442736	0.953	Plexin-B3
2	9606.ENSP00000351338	0.952	Plexin-B1
3	9606.ENSP00000409171	0.952	Plexin-B2
4	9606.ENSP00000358696	0.886	Plexin-A3
5	9606.ENSP00000377061	0.886	Plexin-A1
6	9606.ENSP00000317128	0.885	Plexin-D1
7	9606.ENSP00000356000	0.885	Plexin-A2
8	9606.ENSP00000353582	0.796	Neuropilin-2
9	9606.ENSP00000265371	0.780	Neuropilin-1
10	9606.ENSP00000173229	0.670	Netrin-1
11	9606.ENSP00000404296	0.631	Pleckstrin homology domain containing A5
12	9606.ENSP00000478570	0.610	Vascular endothelial growth factor A
13	9606.ENSP00000275815	0.576	Ephrin type-A receptor 1
14	9606.ENSP00000332164	0.575	Slit homolog 3 protein
15	9606.ENSP00000259053	0.573	CD302 antigen
16	9606.ENSP00000337838	0.560	Reticulon-4
17	9606.ENSP00000210313	0.556	26S proteasome non-ATPase regulatory subunit 5
18	9606.ENSP00000422591	0.547	Slit homolog 2 protein
19	9606.ENSP00000233668	0.538	Docking protein 1
20	9606.ENSP00000290401	0.533	Neuroplastin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0048667	0.992	cell morphogenesis involved in neuron differentiation
GO:0048812	0.992	neuron projection morphogenesis
GO:0006935	0.977	chemotaxis
GO:0050794	0.976	regulation of cellular process
GO:0097485	0.947	neuron projection guidance
GO:0007411	0.943	axon guidance
GO:0007154	0.826	cell communication
GO:0023052	0.819	signaling
GO:0050793	0.760	regulation of developmental process
GO:0051128	0.736	regulation of cellular component organization
GO:0031344	0.732	regulation of cell projection organization
GO:0051239	0.687	regulation of multicellular organismal process
GO:0048519	0.677	negative regulation of biological process
GO:0048523	0.616	negative regulation of cellular process
GO:0022603	0.612	regulation of anatomical structure morphogenesis
GO:0048518	0.588	positive regulation of biological process
GO:0120035	0.566	regulation of plasma membrane bounded cell projection organization
GO:0010975	0.561	regulation of neuron projection development
GO:0048522	0.504	positive regulation of cellular process
GO:0051716	0.497	cellular response to stimulus
GO:2000026	0.446	regulation of multicellular organismal development
GO:0007165	0.434	signal transduction
GO:0065008	0.394	regulation of biological quality
GO:0008361	0.366	regulation of cell size
GO:0050770	0.366	regulation of axonogenesis
GO:0030516	0.358	regulation of axon extension
GO:0051960	0.337	regulation of nervous system development
GO:0050767	0.332	regulation of neurogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.911	organelle
GO:0005622	0.815	intracellular anatomical structure
GO:0005737	0.813	cytoplasm
GO:0043227	0.809	membrane-bounded organelle
GO:0043231	0.790	intracellular membrane-bounded organelle
GO:0012505	0.534	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]