StarFunc result for job id O95759

User Input

>input (1140 residues)
MWLKPEEVLLKNALKLWVTQKSSCYFILQRRRGHGEGGGRLTGRLVGALDAVLDSNARVA
PFRILLQVPGSQVYSPIACGATLEEINQHWDWLEQNLLHTLSVFDNKDDIASFVKGKVKA
LIAEETSSRLAEQEEEPEKFREALVKFEARFNFPEAEKLVTYYSCCCWKGRVPRQGWLYL
SINHLCFYSFFLGKELKLVVPWVDIQKLERTSNVFLTDTIRITTQNKERDFSMFLNLDEV
FKVMEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLH
AVVDCSLWTPFSRCHTTGRMFASDSYICFASREDGCCKIILPLREVVSIEKMEDTSLLPH
PIIVSIRSKVAFQFIELRDRDSLVEALLARLKQVHANHPVHYDTSADDDMASLVFHSTSM
CSDHRFGDLEMMSSQNSEESEKEKSPLMHPDALVTAFQQSGSQSPDSRMSREQIKISLWN
DHFVEYGRTVCMFRTEKIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNLVEESL
GKCCLVTEEIERDLHRSLPEHPAFQNETGIAALRRVLTAYAHRNPKIGYCQSMNILTSVL
LLYTKEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIKGHLPELAEHMNDLSAL
ASVSLSWFLTLFLSIMPLESAVNVVDCFFYDGIKAIFQLGLAVLEANAEDLCSSKDDGQA
LMILSRFLDHIKNEDSPGPPVGSHHAFFSDDQEPYPVTDISDLIRDSYEKFGDQSVEQIE
HLRYKHRIRVLQGHEDTTKQNVLRVVIPEVSILPEDLEELYDLFKREHMMSCYWEQPRPM
ASRHDPSRPYAEQYRIDARQFAHLFQLVSPWTCGAHTEILAERTFRLLDDNMDQLIEFKA
FVSCLDIMYNGEMNEKIKLLYRLHIPPALTENDRDSQSPLRNPLLSTSRPLVFGKPNGDA
VDYQKQLKQMIKDLAKEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATV
TTLLLQIGEVGQRGSSSGSCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERD
WTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSELKLSNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95759	1.000	1.000	0.000	1140	1.000	1.000	O95759.pdb.gz	TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens OX=9606 GN=TBC1D8 PE=1 SV=3
2	AFDB:Q0IIM8	0.856	0.871	1.867E-103	1120	0.533	0.543	Q0IIM8.pdb.gz	TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens OX=9606 GN=TBC1D8B PE=1 SV=2
3	AFDB:Q6ZT07	0.812	0.736	1.189E-99	1266	0.505	0.455	Q6ZT07.pdb.gz	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
4	AFDB:Q66K14	0.820	0.751	2.916E-99	1250	0.520	0.474	Q66K14.pdb.gz	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
5	AFDB:B0R0W9	0.723	0.742	1.449E-93	1108	0.492	0.506	B0R0W9.pdb.gz	TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio OX=7955 GN=tbc1d8b PE=1 SV=1
6	AFDB:O43048	0.486	0.646	1.485E-31	834	0.151	0.206	O43048.pdb.gz	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
7	AFDB:P53258	0.476	0.565	2.003E-31	950	0.173	0.207	P53258.pdb.gz	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
8	AFDB:O94711	0.464	0.704	2.408E-28	720	0.149	0.236	O94711.pdb.gz	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
9	AFDB:Q75JG4	0.334	0.380	8.297E-19	986	0.139	0.161	Q75JG4.pdb.gz	Q75JG4_DICDI RabGAP/TBC domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=cnrF PE=4 SV=1
10	AFDB:P87234	0.259	0.449	3.460E-14	635	0.091	0.164	P87234.pdb.gz	GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp3 PE=1 SV=1
11	PDB:6xtbE	0.078	0.322	4.631E-7	235	0.033	0.162	6xtbE.pdb.gz
12	PDB:5yqrA	0.089	0.365	5.760E-6	268	0.044	0.187	5yqrA.pdb.gz
13	PDB:7nkyO	0.075	0.169	3.196E-4	427	0.025	0.066	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
14	PDB:3ljuX	0.102	0.246	3.335E-4	373	0.023	0.070	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
15	PDB:7nkyQ	0.075	0.178	3.335E-4	404	0.036	0.101	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
16	PDB:7c3mA	0.077	0.138	1.488E-3	577	0.025	0.049	7c3mA.pdb.gz
17	PDB:6upkH	0.077	0.190	1.923E-3	411	0.022	0.061	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
18	PDB:1lw3A	0.086	0.185	2.380E-3	513	0.027	0.060	1lw3A.pdb.gz
19	PDB:4mk0A	0.083	0.142	7.545E-3	631	0.016	0.029	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:7ukhI	0.121	0.635	1.207E-2	181	0.027	0.171	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L3A9	0.0	1060	1232	0.496	0.459	A1L3A9_HUMAN TBC1 domain family, member 9B (With GRAM domain) OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=1
2	B0R0W9	0.0	1035	1108	0.497	0.512	TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio OX=7955 GN=tbc1d8b PE=1 SV=1
3	O95759	0.0	2367	1140	1.000	1.000	TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens OX=9606 GN=TBC1D8 PE=1 SV=3
4	Q0IIM8	0.0	1153	1120	0.537	0.546	TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens OX=9606 GN=TBC1D8B PE=1 SV=2
5	Q66K14	0.0	1060	1250	0.499	0.455	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
6	Q6ZT07	0.0	1069	1266	0.478	0.430	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
7	P53258	1.56e-71	260	950	0.162	0.195	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
8	O43048	1.95e-61	228	834	0.113	0.155	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
9	O94711	1.05e-53	203	720	0.132	0.208	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
10	Q96HU1	6.44e-39	158	749	0.075	0.115	SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens OX=9606 GN=SGSM3 PE=1 SV=1
11	Q8VCZ6	3.27e-38	156	750	0.075	0.113	SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus OX=10090 GN=Sgsm3 PE=1 SV=1
12	P87234	9.20e-37	150	635	0.072	0.129	GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp3 PE=1 SV=1
13	Q12317	2.34e-36	147	492	0.079	0.183	MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSB4 PE=1 SV=1
14	Q75JG4	4.40e-35	147	986	0.115	0.133	Q75JG4_DICDI RabGAP/TBC domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=cnrF PE=4 SV=1
15	Q23419	6.10e-34	143	908	0.071	0.089	Q23419_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tbc-2 PE=1 SV=2
16	Q9UPU7	6.20e-33	140	963	0.075	0.089	TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B PE=1 SV=2
17	Q9VGL8	7.46e-32	130	363	0.063	0.198	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
18	Q8C9V1	7.82e-32	132	444	0.066	0.169	TB10C_MOUSE Carabin OS=Mus musculus OX=10090 GN=Tbc1d10c PE=1 SV=1
19	P48566	1.29e-31	134	633	0.075	0.136	GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSB3 PE=1 SV=1
20	Q9BXI6	1.80e-31	132	508	0.069	0.156	TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens OX=9606 GN=TBC1D10A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02836 Glyco_hydro_2_C	2e+02	12.5	Glycosyl hydrolases family 2, TIM barrel domain
2	PF02893 GRAM	2.1e-40	148.6	GRAM domain
3	PF00566 RabGAP-TBC	7.4e-41	151.7	Rab-GTPase-TBC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295317	0.773	E3 ubiquitin-protein ligase RNF149
2	9606.ENSP00000360690	0.672	LON peptidase N-terminal domain and ring finger 3
3	9606.ENSP00000362590	0.662	TBC1 domain family member 22B
4	9606.ENSP00000343658	0.650	Mitogen-activated protein kinase kinase kinase kinase 4
5	9606.ENSP00000330959	0.628	Interleukin-1 receptor type 2
6	9606.ENSP00000386717	0.607	Ribosomal protein L31
7	9606.ENSP00000377086	0.578	LON peptidase N-terminal domain and ring finger 2
8	9606.ENSP00000411197	0.558	TBC1 domain family member 9
9	9606.ENSP00000307911	0.556	Carbohydrate sulfotransferase 2
10	9606.ENSP00000346139	0.552	TBC1 domain family member 20
11	9606.ENSP00000268989	0.542	Small G protein signaling modulator 2
12	9606.ENSP00000345752	0.539	Myotubularin-related protein 2
13	9606.ENSP00000398722	0.538	Chitinase domain-containing protein 1
14	9606.ENSP00000441032	0.538	GRAM domain-containing protein 1A
15	9606.ENSP00000448182	0.518	TBC1 domain family member 15
16	9606.ENSP00000377700	0.512	TBC1 domain family member 23
17	9606.ENSP00000264866	0.500	TBC1 domain family member 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0098772	0.355	molecular function regulator activity
GO:0030234	0.352	enzyme regulator activity
GO:0008047	0.336	enzyme activator activity
GO:0005096	0.328	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0032501	0.984	multicellular organismal process
GO:0050794	0.981	regulation of cellular process
GO:0003008	0.971	system process
GO:0048518	0.951	positive regulation of biological process
GO:0048522	0.929	positive regulation of cellular process
GO:0003013	0.844	circulatory system process
GO:0042127	0.738	regulation of cell population proliferation
GO:0008284	0.557	positive regulation of cell population proliferation
GO:0008015	0.546	blood circulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005622	0.935	intracellular anatomical structure
GO:0005737	0.933	cytoplasm
GO:0005829	0.542	cytosol
GO:0043226	0.432	organelle
GO:0043229	0.412	intracellular organelle
GO:0043227	0.404	membrane-bounded organelle
GO:0043231	0.326	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]