StarFunc result for job id O95760

User Input

>input (270 residues)
MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYF
RRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPIT
EYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGK
MLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFI
GVKDNHLALIKVDSSENLCTENILFKLSET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95760	1.000	1.000	9.216E-47	270	1.000	1.000	O95760.pdb.gz	IL33_HUMAN Interleukin-33 OS=Homo sapiens OX=9606 GN=IL33 PE=1 SV=1
2	AFDB:Q8BVZ5	0.566	0.574	1.555E-27	266	0.511	0.519	Q8BVZ5.pdb.gz	IL33_MOUSE Interleukin-33 OS=Mus musculus OX=10090 GN=Il33 PE=1 SV=1
3	AFDB:Q66H70	0.568	0.581	1.116E-24	264	0.504	0.515	Q66H70.pdb.gz	IL33_RAT Interleukin-33 OS=Rattus norvegicus OX=10116 GN=Il33 PE=2 SV=1
4	AFDB:P01583	0.428	0.426	2.033E-6	271	0.163	0.162	P01583.pdb.gz	IL1A_HUMAN Interleukin-1 alpha OS=Homo sapiens OX=9606 GN=IL1A PE=1 SV=1
5	AFDB:A0A060WTK5	0.446	0.461	2.375E-6	260	0.100	0.104	A0A060WTK5.pdb.gz	A0A060WTK5_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00005489001 PE=3 SV=1
6	AFDB:P01582	0.411	0.411	2.375E-6	270	0.137	0.137	P01582.pdb.gz	IL1A_MOUSE Interleukin-1 alpha OS=Mus musculus OX=10090 GN=Il1a PE=1 SV=1
7	AFDB:P16598	0.411	0.411	3.076E-6	270	0.159	0.159	P16598.pdb.gz	IL1A_RAT Interleukin-1 alpha OS=Rattus norvegicus OX=10116 GN=Il1a PE=2 SV=1
8	AFDB:Q90W84	0.440	0.453	3.986E-6	261	0.096	0.100	Q90W84.pdb.gz	Q90W84_DICLA Interleukin-1 OS=Dicentrarchus labrax OX=13489 GN=IL-1b PE=2 SV=1
9	PDB:3v0aB	0.353	0.096	2.205E-5	1150	0.093	0.022	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
10	AFDB:Q945P1	0.357	0.311	3.162E-5	317	0.096	0.082	Q945P1.pdb.gz	EULS3_ARATH Ricin B-like lectin EULS3 OS=Arabidopsis thaliana OX=3702 GN=EULS3 PE=1 SV=1
11	PDB:1md6A	0.362	0.590	1.043E-4	154	0.074	0.130	1md6A.pdb.gz
12	PDB:4izeA	0.378	0.621	1.351E-4	152	0.078	0.138	4izeA.pdb.gz
13	PDB:5bowA	0.377	0.624	2.789E-4	151	0.070	0.126	5bowA.pdb.gz
14	PDB:4qd2B	0.374	0.658	5.467E-4	143	0.056	0.105	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
15	PDB:6hpiA	0.354	0.547	6.386E-4	158	0.085	0.146	6hpiA.pdb.gz
16	PDB:6b0tA	0.341	0.201	1.462E-3	487	0.081	0.045	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
17	PDB:7t3qA	0.380	0.059	1.540E-3	2103	0.063	0.008	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:2d43A	0.380	0.225	2.330E-3	482	0.070	0.039	2d43A.pdb.gz	The family 42 carbohydrate-binding module of family 54 alpha-L-arabinofuranosidase specifically binds the arabinofuranose side chain of hemicellulose
19	PDB:3nbcA	0.356	0.591	4.119E-3	148	0.059	0.108	3nbcA.pdb.gz	Bivalent carbohydrate binding is required for biological activity of Clitocybe nebularis lectin (CNL), the N,N'-diacetyllactosediamine (GalNAc beta 1-4GlcNAc, LacdiNAc)-specific lectin from basidiomycete C. nebularis
20	AFDB:Q86VV4	0.158	0.106	2.390E-2	465	0.119	0.069	Q86VV4.pdb.gz	RNB3L_HUMAN Ran-binding protein 3-like OS=Homo sapiens OX=9606 GN=RANBP3L PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95760	0.0	564	270	1.000	1.000	IL33_HUMAN Interleukin-33 OS=Homo sapiens OX=9606 GN=IL33 PE=1 SV=1
2	Q8BVZ5	1.50e-85	258	266	0.522	0.530	IL33_MOUSE Interleukin-33 OS=Mus musculus OX=10090 GN=Il33 PE=1 SV=1
3	Q66H70	4.12e-83	251	264	0.526	0.538	IL33_RAT Interleukin-33 OS=Rattus norvegicus OX=10116 GN=Il33 PE=2 SV=1
4	Q97T03	0.53	33.1	156	0.074	0.128	NRDIL_STRPN Putative NrdI-like protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0158 PE=1 SV=1
5	P0A823	1.2	32.7	234	0.074	0.085	SFSA_ECOLI Sugar fermentation stimulation protein A OS=Escherichia coli (strain K12) OX=83333 GN=sfsA PE=1 SV=1
6	L8B080	5.8	30.8	642	0.078	0.033	L8B080_PHATR Solute carrier protein 4 family OS=Phaeodactylum tricornutum OX=2850 GN=ptSLC4-2 PE=2 SV=1
7	Q5H8B9	6.3	30.8	2123	0.070	0.009	FREM3_MOUSE FRAS1-related extracellular matrix protein 3 OS=Mus musculus OX=10090 GN=Frem3 PE=2 SV=2
8	Q54FJ6	7.2	30.8	1076	0.056	0.014	Q54FJ6_DICDI EGF-like domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0290835 PE=4 SV=1
9	A0A8I6AND4	8.3	30.4	725	0.096	0.036	A0A8I6AND4_RAT Relaxin family peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Rxfp2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05270 AbfB	54	15.2	Alpha-L-arabinofuranosidase B (ABFB) domain
2	PF15095 IL33	1.4e-131	449.5	Interleukin 33

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370842

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233954	0.999	Interleukin-1 receptor-like 1
2	9606.ENSP00000314807	0.998	Interleukin 1 receptor accessory protein
3	9606.ENSP00000433138	0.968	Caspase-1
4	9606.ENSP00000368632	0.967	Trans-acting T-cell-specific transcription factor GATA-3
5	9606.ENSP00000332194	0.961	Histone H2A type 2-C
6	9606.ENSP00000401399	0.916	Myeloid differentiation primary response protein MyD88
7	9606.ENSP00000339804	0.881	Thymic stromal lymphopoietin
8	9606.ENSP00000231454	0.867	Interleukin-5
9	9606.ENSP00000304915	0.864	Interleukin-13
10	9606.ENSP00000226730	0.849	Interleukin-2
11	9606.ENSP00000386380	0.843	Interleukin-1 receptor type 1
12	9606.ENSP00000231449	0.835	Interleukin-4
13	9606.ENSP00000280357	0.816	Interleukin-18
14	9606.ENSP00000387211	0.807	Interleukin-18 receptor 1
15	9606.ENSP00000358151	0.799	Histone H2B type 2-E
16	9606.ENSP00000390651	0.784	Interleukin-1 receptor-associated kinase 4
17	9606.ENSP00000358997	0.776	Interleukin-1 receptor-associated kinase 1
18	9606.ENSP00000433623	0.774	TNF receptor-associated factor 6
19	9606.ENSP00000263341	0.770	Interleukin-1 beta
20	9606.ENSP00000344192	0.759	Interleukin-17A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0032103	0.993	positive regulation of response to external stimulus
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0031349	0.988	positive regulation of defense response
GO:0050729	0.981	positive regulation of inflammatory response
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0048519	0.978	negative regulation of biological process
GO:0001819	0.972	positive regulation of cytokine production
GO:0002696	0.967	positive regulation of leukocyte activation
GO:0032642	0.966	regulation of chemokine production
GO:0048523	0.960	negative regulation of cellular process
GO:0043030	0.952	regulation of macrophage activation
GO:0010605	0.930	negative regulation of macromolecule metabolic process
GO:0050896	0.890	response to stimulus
GO:0009987	0.880	cellular process
GO:0031324	0.827	negative regulation of cellular metabolic process
GO:0051716	0.755	cellular response to stimulus
GO:0051172	0.689	negative regulation of nitrogen compound metabolic process
GO:0009890	0.628	negative regulation of biosynthetic process
GO:0007154	0.616	cell communication
GO:0023052	0.611	signaling
GO:0032722	0.531	positive regulation of chemokine production
GO:0006357	0.513	regulation of transcription by RNA polymerase II
GO:0007165	0.476	signal transduction
GO:0045934	0.471	negative regulation of nucleobase-containing compound metabolic process
GO:0006950	0.431	response to stress
GO:0002376	0.420	immune system process
GO:0009605	0.395	response to external stimulus
GO:0042221	0.391	response to chemical
GO:0032501	0.386	multicellular organismal process
GO:0051173	0.370	positive regulation of nitrogen compound metabolic process
GO:0042127	0.361	regulation of cell population proliferation
GO:0031327	0.354	negative regulation of cellular biosynthetic process
GO:0051253	0.354	negative regulation of RNA metabolic process
GO:0010558	0.345	negative regulation of macromolecule biosynthetic process
GO:0045892	0.340	negative regulation of DNA-templated transcription
GO:0031325	0.338	positive regulation of cellular metabolic process
GO:0006952	0.334	defense response
GO:0070887	0.313	cellular response to chemical stimulus
GO:0006955	0.308	immune response
GO:0010033	0.306	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.996	cytoplasm
GO:0070013	0.995	intracellular organelle lumen
GO:0005576	0.986	extracellular region
GO:0005654	0.977	nucleoplasm
GO:0071944	0.501	cell periphery
GO:0005886	0.480	plasma membrane
GO:0005615	0.394	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]