StarFunc result for job id O95780

User Input

>input (498 residues)
MELLTFRDVTIEFSLEEWEFLNPAQQSLYRKVMLENYRNLVSLGLTVSKPELISRLEQRQ
EPWNVKRHETIAKPPAMSSHYTEDLLPEQCMQDSFQKVILRRYGSCGLEDLHLRKDGENV
GECKDQKEIYNGLNQCLSTLPSKIFPYNKCVKVFSKSSNLNRENIRHTTEKLFKCMQCGK
VFKSHSGLSYHKIIHTEEKLCICEECGKTFKWFSYLTKHKRIHTGEKPYKCEECGKAFNW
CSSLTKHKRIHTGEKPYKCEECGKAFHWCSPFVRHKKIHTGEKPYTCEDCGRAFNRHSHL
TKHKTIHTGKKPYKCKECGKAFNHCSLLTIHERTHTGEKPYKCEECGKAFNSSSILTEHK
VIHSGEKPYKCEKCDKVFKRFSYLTKHKRIHTGEKPYKCEECGKAFNWSSILTEHKRIHT
GEKPYNCEECGKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKS
CKYKKCGEAFNHCSNLTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75437	0.426	0.336	3.005E-51	659	0.643	0.486	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
2	AFDB:Q03936	0.453	0.395	6.781E-51	586	0.641	0.544	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
3	AFDB:Q8IYN0	0.469	0.439	5.330E-50	542	0.635	0.583	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
4	AFDB:Q14593	0.533	0.472	6.272E-50	569	0.604	0.529	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
5	AFDB:Q05481	0.343	0.173	1.139E-49	1191	0.618	0.259	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
6	AFDB:A6NNF4	0.426	0.302	2.185E-49	738	0.624	0.421	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
7	AFDB:Q03923	0.477	0.412	5.495E-49	595	0.614	0.514	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
8	AFDB:Q96JC4	0.483	0.462	6.125E-49	524	0.600	0.571	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
9	AFDB:Q9H8G1	0.482	0.431	1.382E-48	570	0.643	0.561	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
10	AFDB:Q15928	0.397	0.415	1.627E-48	474	0.562	0.591	Q15928.pdb.gz	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
11	PDB:3w5kB	0.095	0.269	6.830E-4	110	0.086	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.046	0.219	9.300E-1	62	0.020	0.161	6ydhA.pdb.gz
13	PDB:7kpxC	0.077	0.041	1.689	1352	0.102	0.038	7kpxC.pdb.gz
14	PDB:7c4jB	0.083	0.085	1.783	395	0.118	0.149	7c4jB.pdb.gz
15	PDB:7uhyC	0.042	0.037	1.783	578	0.030	0.026	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:5dkaA	0.064	0.222	2.216	96	0.032	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	PDB:7kpvC	0.065	0.066	2.470	487	0.104	0.107	7kpvC.pdb.gz
18	PDB:4kfzB	0.064	0.152	2.753	148	0.044	0.149	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
19	PDB:3j9qA	0.062	0.079	4.025	385	0.026	0.034	3j9qA.pdb.gz
20	PDB:6iczL	0.070	0.075	4.249	454	0.098	0.108	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	0.0	593	616	0.645	0.521	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	0.0	602	659	0.655	0.495	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	0.0	593	809	0.622	0.383	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	0.0	607	620	0.627	0.503	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	0.0	611	595	0.661	0.553	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	0.0	618	586	0.651	0.553	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	0.0	582	1191	0.629	0.263	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	0.0	594	569	0.627	0.548	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	0.0	579	474	0.582	0.612	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	0.0	635	569	0.653	0.571	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q8IW36	0.0	570	515	0.614	0.594	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
12	Q8IYB9	0.0	607	648	0.635	0.488	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
13	Q8IYN0	0.0	608	542	0.637	0.585	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
14	Q8TD23	0.0	585	568	0.612	0.537	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
15	Q96H40	0.0	530	463	0.552	0.594	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
16	Q96JC4	0.0	581	524	0.606	0.576	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
17	Q9H8G1	0.0	631	570	0.653	0.570	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
18	Q5JVG8	2.29e-177	507	444	0.522	0.586	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
19	Q49A12	4.39e-176	507	536	0.558	0.519	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
20	Q8IYX0	4.63e-176	503	411	0.520	0.630	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07754 HVO_2753_ZBP	47	15.2	Small zinc finger protein HVO_2753-like, Zn-binding pocket
2	PF01352 KRAB	3e-19	79.6	KRAB box
3	PF08646 Rep_fac-A_C	1.9e+02	13.2	Replication factor-A C terminal domain
4	PF01286 XPA_N	0.072	24.4	XPA protein N-terminal
5	PF00096 zf-C2H2	9.4e-43	153.5	Zinc finger, C2H2 type
6	PF13894 zf-C2H2_4	1.3e-17	74.0	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	8.7e-12	56.0	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	2.8	19.6	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	1.4e-76	261.0	Zinc-finger double domain
10	PF02591 zf-RING_7	1.4	20.4	C4-type zinc ribbon domain
11	PF13451 zf-trcl	64	14.9	Probable zinc-ribbon domain
12	PF18387 zf_C2H2_ZHX	3.5e+02	12.3	Zinc-fingers and homeoboxes C2H2 finger domain
13	PF18439 zf_UBZ	0.00017	32.5	Ubiquitin-Binding Zinc Finger
14	PF09723 Zn-ribbon_8	4.9e-07	41.1	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401010	0.653	F-actin-capping protein subunit beta
2	9606.ENSP00000370882	0.646	OCIA domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048519	0.977	negative regulation of biological process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0019219	0.954	regulation of nucleobase-containing compound metabolic process
GO:0009892	0.952	negative regulation of metabolic process
GO:0031326	0.949	regulation of cellular biosynthetic process
GO:0048523	0.937	negative regulation of cellular process
GO:0031324	0.871	negative regulation of cellular metabolic process
GO:0060255	0.864	regulation of macromolecule metabolic process
GO:0051172	0.831	negative regulation of nitrogen compound metabolic process
GO:0031327	0.821	negative regulation of cellular biosynthetic process
GO:0010558	0.811	negative regulation of macromolecule biosynthetic process
GO:0045934	0.808	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.785	regulation of DNA-templated transcription
GO:1902679	0.785	negative regulation of RNA biosynthetic process
GO:0045892	0.744	negative regulation of DNA-templated transcription
GO:0009987	0.654	cellular process
GO:0006357	0.419	regulation of transcription by RNA polymerase II
GO:0071704	0.301	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.944	cytoplasm
GO:0016020	0.776	membrane
GO:0005829	0.506	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]