StarFunc result for job id O95785

User Input

>input (1651 residues)
MEGSLAGSLAAPDRPQGPERLPGPAPRENIEGGAEAAEGEGGIFRSTRYLPVTKEGPRDI
LDGRGGISGTPDGRGPWEHPLVQEAGEGILSERRFEDSVIVRTMKPHAELEGSRRFLHHR
GEPRLLEKHAQGRPRFDWLQDEDEQGSPQDAGLHLDLPAQPPPLAPFRRVFVPVEDTPKT
LDMAVVGGREDLEDLEGLAQPSEWGLPTSASEVATQTWTVNSEASVERLQPLLPPIRTGP
YLCELLEEVAEGVASPDEDEDEEPAVFPCIECSIYFKQKEHLLEHMSQHRRAPGQEPPAD
LAPLACGECGWAFADPTALEQHRQLHQASREKIIEEIQKLKQVPGDEGREARLQCPKCVF
GTNSSRAYVQHAKLHMREPPGQTTKEPFGGSSGAGSPSPEASALLYQPYGAAVGLSACVF
CGFPAPSESLLREHVRLVHAHPHWEEDGEAYEEDPASQPGTSQDAHACFPDTAVDYFGKA
EPSLAPMWRENPAGYDPSLAFGPGCQQLSIRDFPLSKPLLHGTGQRPLGRLAFPSTLAST
PYSLQLGRNKSTVHPQGLGERRRPWSEEEEEEEEEEDVVLTSEMDFSPENGVFSPLATPS
LIPQAALELKQAFREALQAVEATQGQQQQLRGMVPIVLVAKLGPQVMAAARVPPRLQPEE
LGLAGAHPLDFLLLDAPLGGPLGLDTLLDGDPAMALKHEERKCPYCPDRFHNGIGLANHV
RGHLNRVGVSYNVRHFISAEEVKAIERRFSFQKKKKKVANFDPGTFSLMRCDFCGAGFDT
RAGLSSHARAHLRDFGITNWELTVSPINILQELLATSAAEQPPSPLGREPGGPPGSFLTS
RRPRLPLTVPFPPTWAEDPGPAYGDAQSLTTCEVCGACFETRKGLSSHARSHLRQLGVAE
SESSGAPIDLLYELVKQKGLPDAHLGLPPGLAKKSSSLKEVVAGAPRPGLLSLAKPLDAP
AVNKAIKSPPGFSAKGLGHPPSSPLLKKTPLALAGSPTPKNPEDKSPQLSLSPRPASPKA
QWPQSEDEGPLNLTSGPEPARDIRCEFCGEFFENRKGLSSHARSHLRQMGVTEWYVNGSP
IDTLREILKRRTQSRPGGPPNPPGPSPKALAKMMGGAGPGSSLEARSPSDLHISPLAKKL
PPPPGSPLGHSPTASPPPTARKMFPGLAAPSLPKKLKPEQIRVEIKREMLPGALHGELHP
SEGPWGAPREDMTPLNLSSRAEPVRDIRCEFCGEFFENRKGLSSHARSHLRQMGVTEWSV
NGSPIDTLREILKKKSKPCLIKKEPPAGDLAPALAEDGPPTVAPGPVQSPLPLSPLAGRP
GKPGAGPAQVPRELSLTPITGAKPSATGYLGSVAAKRPLQEDRLLPAEVKAKTYIQTELP
FKAKTLHEKTSHSSTEACCELCGLYFENRKALASHARAHLRQFGVTEWCVNGSPIETLSE
WIKHRPQKVGAYRSYIQGGRPFTKKFRSAGHGRDSDKRPSLGLAPGGLAVVGRSAGGEPG
PEAGRAADGGERPLAASPPGTVKAEEHQRQNINKFERRQARPPDASAARGGEDTNDLQQK
LEEVRQPPPRVRPVPSLVPRPPQTSLVKFVGNIYTLKCRFCEVEFQGPLSIQEEWVRHLQ
RHILEMNFSKADPPPEESQAPQAQTAAAEAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88286	0.281	0.277	0.000	1684	0.838	0.821	O88286.pdb.gz	WIZ_MOUSE Protein Wiz OS=Mus musculus OX=10090 GN=Wiz PE=1 SV=2
2	AFDB:O95785	1.000	1.000	0.000	1651	1.000	1.000	O95785.pdb.gz	WIZ_HUMAN Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=2
3	AFDB:Q92766	0.054	0.054	1.714E-11	1687	0.162	0.159	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
4	AFDB:A0A0K3AUE4	0.043	0.039	2.503E-6	1968	0.162	0.136	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
5	AFDB:Q5BIH1	0.037	0.058	1.647E-5	803	0.079	0.162	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
6	AFDB:Q9Y2X9	0.047	0.068	2.637E-5	895	0.089	0.164	Q9Y2X9.pdb.gz	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
7	AFDB:Q8IWB4	0.037	0.042	9.630E-5	1347	0.136	0.166	Q8IWB4.pdb.gz	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
8	AFDB:Q59GP6	0.053	0.060	3.316E-4	1099	0.108	0.162	Q59GP6.pdb.gz	Q59GP6_HUMAN Polyhomeotic-like protein 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
9	AFDB:Q9W2E1	0.038	0.035	5.973E-4	1870	0.165	0.145	Q9W2E1.pdb.gz	STUM_DROME Protein stum OS=Drosophila melanogaster OX=7227 GN=stum PE=2 SV=3
10	AFDB:Q383H0	0.033	0.037	7.559E-4	1439	0.130	0.149	Q383H0.pdb.gz	Q383H0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2880 PE=4 SV=1
11	PDB:7ky1A	0.035	0.184	1.393	189	0.008	0.069	7ky1A.pdb.gz
12	PDB:6h1cB	0.025	0.148	1.983	134	0.012	0.142	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
13	PDB:6rw4O	0.026	0.140	2.366	194	0.013	0.113	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
14	PDB:6gawAp	0.023	0.136	2.994	190	0.016	0.137	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
15	PDB:7ajtCK	0.020	0.098	3.176	207	0.012	0.097	7ajtCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:6bk8O	0.023	0.099	3.573	229	0.008	0.057	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:6ff79	0.028	0.093	3.573	432	0.018	0.067	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:4v4kY	0.034	0.184	4.019	146	0.010	0.116	4v4kY.pdb.gz
19	PDB:6ajkA	0.021	0.097	4.019	293	0.004	0.020	6ajkA.pdb.gz	Structural insights into dimethylation of 12S rRNA by TFB1M: indispensable role in translation of mitochondrial genes and mitochondrial function.
20	PDB:6hivCb	0.034	0.133	4.019	252	0.020	0.131	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YFV2	0.0	3291	1699	1.000	0.972	A0A2R8YFV2_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
2	A0A669KAV7	0.0	1330	1889	0.436	0.381	A0A669KAV7_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
3	A0A669KBG4	0.0	1568	933	0.476	0.842	A0A669KBG4_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
4	A0A669KBH9	0.0	1135	1066	0.369	0.571	A0A669KBH9_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
5	B9EGQ5	0.0	1568	832	0.476	0.945	B9EGQ5_HUMAN WIZ protein OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
6	M0QXA7	0.0	1135	968	0.369	0.629	M0QXA7_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
7	O88286	0.0	2605	1684	0.838	0.822	WIZ_MOUSE Protein Wiz OS=Mus musculus OX=10090 GN=Wiz PE=1 SV=2
8	O95785	0.0	3315	1651	1.000	1.000	WIZ_HUMAN Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=2
9	Q9H582	6.08e-29	129	1327	0.047	0.058	ZN644_HUMAN Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 PE=1 SV=2
10	A2BIH4	6.46e-14	79.7	1169	0.041	0.057	A2BIH4_DANRE Zinc finger protein 644a OS=Danio rerio OX=7955 GN=fi40c02 PE=4 SV=1
11	Q9UJL9	2.41e-06	54.7	534	0.022	0.067	ZF69B_HUMAN Zinc finger protein 69 homolog B OS=Homo sapiens OX=9606 GN=ZFP69B PE=1 SV=2
12	P0CG24	2.74e-06	53.9	379	0.024	0.106	ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens OX=9606 GN=ZNF883 PE=1 SV=1
13	A0A024RCN4	1.23e-05	52.4	479	0.025	0.086	A0A024RCN4_HUMAN Zinc finger and SCAN domain containing 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=1
14	Q15937	1.26e-05	52.4	498	0.036	0.118	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
15	Q16670	1.28e-05	52.0	478	0.025	0.086	ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=2
16	Q9BRH9	1.43e-05	52.4	671	0.030	0.073	ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens OX=9606 GN=ZNF251 PE=1 SV=4
17	Q14585	1.78e-05	51.6	488	0.031	0.107	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
18	A0A087X2F1	2.08e-05	51.2	344	0.025	0.119	A0A087X2F1_HUMAN Zinc finger and SCAN domain containing 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=1
19	Q8N9F8	2.13e-05	51.6	522	0.022	0.071	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
20	Q15928	2.19e-05	51.6	474	0.021	0.072	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09582 AnfO_nitrog	7.1e+02	10.9	Iron only nitrogenase protein AnfO (AnfO_nitrog)
2	PF20022 VMAP-M19	3.4e+02	12.8	vWA-MoxR associated protein middle region 19
3	PF00096 zf-C2H2	1.2e-15	68.1	Zinc finger, C2H2 type
4	PF12756 zf-C2H2_2	0.0033	29.1	C2H2 type zinc-finger (2 copies)
5	PF13894 zf-C2H2_4	9.5e-21	83.7	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	7e+02	11.9	Zinc-finger double-stranded RNA-binding
7	PF06467 zf-FCS	0.094	24.0	MYM-type Zinc finger with FCS sequence motif
8	PF17772 zf-MYST	1.5e+02	13.4	MYST family zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000018130

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000050361	0.940	Euchromatic histone-lysine N-methyltransferase 2
2	9598.ENSPTRP00000048599	0.789	Euchromatic histone-lysine N-methyltransferase 1
3	9598.ENSPTRP00000030202	0.718	Chromodomain protein, Y-like
4	9598.ENSPTRP00000039383	0.706	Uncharacterized protein
5	9598.ENSPTRP00000017686	0.705	Syntaxin binding protein 2
6	9598.ENSPTRP00000057500	0.702	Uncharacterized protein
7	9598.ENSPTRP00000027844	0.695	Uncharacterized protein
8	9598.ENSPTRP00000001783	0.694	Family with sequence similarity 102, member B
9	9598.ENSPTRP00000017681	0.694	Uncharacterized protein
10	9598.ENSPTRP00000027965	0.694	Uncharacterized protein
11	9598.ENSPTRP00000018121	0.675	Epoxide hydrolase 3
12	9598.ENSPTRP00000017688	0.668	Pan troglodytes trafficking protein particle complex 5 (TRAPPC5), mRNA
13	9598.ENSPTRP00000017904	0.651	RAB3D, member RAS oncogene family
14	9598.ENSPTRP00000061257	0.613	Pan troglodytes mast cell-expressed membrane protein 1 (C19H19orf59), mRNA
15	9598.ENSPTRP00000017683	0.611	Purkinje cell protein 2
16	9598.ENSPTRP00000008695	0.603	Uncharacterized protein
17	9598.ENSPTRP00000018111	0.597	Synapse defective 1, Rho GTPase, homolog 1
18	9598.ENSPTRP00000006355	0.592	Uncharacterized protein
19	9598.ENSPTRP00000038636	0.592	N(Alpha)-acetyltransferase 10, NatA catalytic subunit
20	9598.ENSPTRP00000017233	0.578	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990226	0.999	histone methyltransferase binding
GO:0044877	0.997	protein-containing complex binding
GO:0003677	0.975	DNA binding
GO:0008134	0.973	transcription factor binding
GO:0000976	0.955	transcription cis-regulatory region binding
GO:0140110	0.910	transcription regulator activity
GO:0003700	0.857	DNA-binding transcription factor activity
GO:0000987	0.784	cis-regulatory region sequence-specific DNA binding
GO:0001221	0.770	transcription coregulator binding
GO:0001222	0.734	transcription corepressor binding
GO:0000981	0.726	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.717	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0045935	0.985	positive regulation of nucleobase-containing compound metabolic process
GO:0031647	0.978	regulation of protein stability
GO:0051726	0.978	regulation of cell cycle
GO:0045740	0.976	positive regulation of DNA replication
GO:0090329	0.948	regulation of DNA-templated DNA replication
GO:2000105	0.943	positive regulation of DNA-templated DNA replication
GO:0045787	0.807	positive regulation of cell cycle
GO:0010564	0.798	regulation of cell cycle process
GO:0090068	0.749	positive regulation of cell cycle process
GO:0009889	0.447	regulation of biosynthetic process
GO:1903506	0.444	regulation of nucleic acid-templated transcription
GO:0010468	0.443	regulation of gene expression
GO:0009987	0.436	cellular process
GO:0050821	0.343	protein stabilization
GO:0006355	0.329	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0030496	0.987	midbody
GO:0005737	0.399	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]