StarFunc result for job id O95786

User Input

>input (925 residues)
MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKF
LLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIP
TDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERN
KFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSP
FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQI
PVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTI
PSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT
DEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMR
DTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFL
YTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESV
SRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGI
LTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGN
VIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKI
LHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKE
CFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG
VQTLYSKWKDFHFEKIPFDPAEMSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95786	1.000	1.000	0.000	925	1.000	1.000	O95786.pdb.gz	RIGI_HUMAN Antiviral innate immune response receptor RIG-I OS=Homo sapiens OX=9606 GN=RIGI PE=1 SV=2
2	AFDB:Q6Q899	0.734	0.733	0.000	926	0.770	0.769	Q6Q899.pdb.gz	RIGI_MOUSE Antiviral innate immune response receptor RIG-I OS=Mus musculus OX=10090 GN=Rigi PE=1 SV=2
3	AFDB:D3TI84	0.627	0.622	2.236E-99	933	0.538	0.534	D3TI84.pdb.gz	D3TI84_ANAPL RNA helicase OS=Anas platyrhynchos OX=8839 GN=RIG-I PE=1 SV=1
4	PDB:8dvsA	0.702	0.942	5.162E-99	682	0.736	0.999	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
5	AFDB:A0A0E3D807	0.709	0.675	7.678E-92	973	0.450	0.428	A0A0E3D807.pdb.gz
6	AFDB:A0A0K0K5Q2	0.709	0.699	2.597E-91	938	0.445	0.439	A0A0K0K5Q2.pdb.gz
7	AFDB:C7C1L7	0.720	0.693	3.653E-91	962	0.468	0.450	C7C1L7.pdb.gz	C7C1L7_SALSA RNA helicase OS=Salmo salar OX=8030 GN=rig-I PE=2 SV=1
8	PDB:7tnxA	0.662	0.933	6.621E-87	647	0.695	0.994	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
9	AFDB:A7LCX1	0.665	0.604	1.395E-63	1023	0.324	0.293	A7LCX1.pdb.gz	A7LCX1_PIG RNA helicase OS=Sus scrofa OX=9823 GN=MDA5 PE=1 SV=1
10	AFDB:A0A0E3D804	0.655	0.610	2.898E-63	997	0.308	0.286	A0A0E3D804.pdb.gz	A0A0E3D804_DANRE RNA helicase OS=Danio rerio OX=7955 GN=MDA5a PE=2 SV=1
11	PDB:4a2wA	0.394	0.509	1.201E-62	678	0.408	0.556	4a2wA.pdb.gz
12	AFDB:D7F7W8	0.652	0.604	2.357E-62	1002	0.303	0.279	D7F7W8.pdb.gz	D7F7W8_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=mda5 PE=2 SV=1
13	AFDB:Q9BYX4	0.656	0.595	2.598E-62	1025	0.332	0.300	Q9BYX4.pdb.gz	IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IFIH1 PE=1 SV=3
14	PDB:7bkpA	0.647	0.853	5.149E-49	689	0.261	0.350	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
15	PDB:6h61A	0.634	0.870	6.195E-44	660	0.259	0.364	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
16	PDB:7w0dA	0.438	0.274	8.587E-22	1544	0.123	0.074	7w0dA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
17	PDB:6buaA	0.358	0.353	3.529E-21	942	0.104	0.102	6buaA.pdb.gz
18	PDB:7v6bA	0.346	0.232	9.356E-21	1496	0.117	0.072	7v6bA.pdb.gz
19	PDB:7yymA	0.324	0.249	1.581E-19	1281	0.135	0.098	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
20	PDB:7v6cA	0.345	0.227	1.829E-19	1540	0.114	0.068	7v6cA.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D5W690	0.0	773	937	0.456	0.450	A0A0D5W690_DANRE RNA helicase OS=Danio rerio OX=7955 GN=rigi PE=2 SV=1
2	C7C1L7	0.0	776	962	0.474	0.455	C7C1L7_SALSA RNA helicase OS=Salmo salar OX=8030 GN=rig-I PE=2 SV=1
3	D3TI84	0.0	994	933	0.537	0.533	D3TI84_ANAPL RNA helicase OS=Anas platyrhynchos OX=8839 GN=RIG-I PE=1 SV=1
4	O95786	0.0	1921	925	1.000	1.000	RIGI_HUMAN Antiviral innate immune response receptor RIG-I OS=Homo sapiens OX=9606 GN=RIGI PE=1 SV=2
5	Q6Q899	0.0	1480	926	0.771	0.770	RIGI_MOUSE Antiviral innate immune response receptor RIG-I OS=Mus musculus OX=10090 GN=Rigi PE=1 SV=2
6	A0A0E3D804	3.78e-113	373	997	0.333	0.309	A0A0E3D804_DANRE RNA helicase OS=Danio rerio OX=7955 GN=MDA5a PE=2 SV=1
7	A7LCX1	3.71e-112	371	1023	0.336	0.304	A7LCX1_PIG RNA helicase OS=Sus scrofa OX=9823 GN=MDA5 PE=1 SV=1
8	Q8R5F7	6.85e-112	370	1025	0.324	0.293	IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ifih1 PE=1 SV=1
9	Q9BYX4	9.22e-111	367	1025	0.281	0.254	IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IFIH1 PE=1 SV=3
10	D7F7W8	4.71e-104	348	1002	0.320	0.295	D7F7W8_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=mda5 PE=2 SV=1
11	A0A060VZM9	2.02e-101	342	1026	0.323	0.291	A0A060VZM9_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00074546001 PE=3 SV=1
12	Q99J87	1.40e-100	331	678	0.251	0.342	DHX58_MOUSE ATP-dependent RNA helicase DHX58 OS=Mus musculus OX=10090 GN=Dhx58 PE=1 SV=2
13	D7F7W9	5.39e-92	308	677	0.249	0.340	D7F7W9_ONCMY RNA helicase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=dhx58 PE=2 SV=1
14	A0A060Y3B2	9.42e-92	307	678	0.250	0.341	A0A060Y3B2_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00027343001 PE=3 SV=1
15	Q96C10	1.12e-91	307	678	0.242	0.330	DHX58_HUMAN ATP-dependent RNA helicase DHX58 OS=Homo sapiens OX=9606 GN=DHX58 PE=1 SV=1
16	D7F7X0	7.72e-84	284	623	0.232	0.345	D7F7X0_ONCMY RNA helicase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=dhx58 PE=2 SV=1
17	G5EDI8	4.69e-73	263	1037	0.231	0.206	G5EDI8_CAEEL Dicer-related helicase OS=Caenorhabditis elegans OX=6239 GN=drh-1 PE=1 SV=1
18	Q93413	9.46e-41	165	1119	0.176	0.146	Q93413_CAEEL Helicase ATP-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=drh-3 PE=1 SV=3
19	Q8TZH8	1.26e-31	135	764	0.150	0.182	Q8TZH8_PYRFU ATP-dependent RNA helicase, putative OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF2015 PE=1 SV=1
20	Q3EBC8	1.23e-24	113	1388	0.142	0.094	DCL2_ARATH Endoribonuclease Dicer homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At3g03300 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	56	15.4	AAA domain
2	PF13481 AAA_25	1.1e+02	13.8	AAA domain
3	PF00006 ATP-synt_ab	4e+02	12.1	ATP synthase alpha/beta family, nucleotide-binding domain
4	PF16739 CARD_2	1.3e-49	177.5	Caspase recruitment domain
5	PF00270 DEAD	1e-14	66.2	DEAD/DEAH box helicase
6	PF00271 Helicase_C	7.9e-13	60.1	Helicase conserved C-terminal domain
7	PF04851 ResIII	6.1e-14	63.9	Type III restriction enzyme, res subunit
8	PF18119 RIG-I_C	1.4e-36	137.0	RIG-I receptor C-terminal domain
9	PF11648 RIG-I_C-RD	2.6e-33	126.1	C-terminal domain of RIG-I

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369213

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323889	0.999	E3 ubiquitin/ISG15 ligase TRIM25
2	9606.ENSP00000401980	0.999	Mitochondrial antiviral-signaling protein
3	9606.ENSP00000425107	0.998	Ubiquitin-like protein ATG12
4	9606.ENSP00000257570	0.997	2'-5'-oligoadenylate synthase-like protein
5	9606.ENSP00000358072	0.997	Autophagy protein 5
6	9606.ENSP00000262510	0.994	Protein NLRC5
7	9606.ENSP00000368699	0.993	Ubiquitin-like protein ISG15
8	9606.ENSP00000377344	0.992	Probable ATP-dependent RNA helicase DDX60
9	9606.ENSP00000441543	0.990	Polyubiquitin-C
10	9606.ENSP00000215794	0.989	Ubl carboxyl-terminal hydrolase 18
11	9606.ENSP00000328340	0.988	E3 ubiquitin-protein ligase RNF135
12	9606.ENSP00000454207	0.985	TNF receptor-associated factor 3
13	9606.ENSP00000380697	0.984	Interferon regulatory factor 7
14	9606.ENSP00000217740	0.983	E3 ubiquitin-protein ligase RNF125
15	9606.ENSP00000242351	0.983	Zinc finger CCCH-type antiviral protein 1
16	9606.ENSP00000329967	0.983	Serine/threonine-protein kinase TBK1
17	9606.ENSP00000272317	0.981	Ubiquitin-40S ribosomal protein S27a
18	9606.ENSP00000392025	0.981	Ubiquitin carboxyl-terminal hydrolase CYLD
19	9606.ENSP00000304697	0.979	Polyubiquitin-B
20	9606.ENSP00000360869	0.979	Interferon-induced protein with tetratricopeptide repeats 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003725	0.999	double-stranded RNA binding
GO:0003727	0.998	single-stranded RNA binding
GO:0003824	0.983	catalytic activity
GO:0140640	0.938	catalytic activity, acting on a nucleic acid
GO:0017111	0.931	ribonucleoside triphosphate phosphatase activity
GO:0140657	0.927	ATP-dependent activity
GO:0008186	0.916	ATP-dependent activity, acting on RNA
GO:0140098	0.916	catalytic activity, acting on RNA
GO:0004386	0.898	helicase activity
GO:0003724	0.870	RNA helicase activity
GO:0042802	0.755	identical protein binding
GO:0019899	0.644	enzyme binding
GO:0043167	0.592	ion binding
GO:0016887	0.477	ATP hydrolysis activity
GO:0097367	0.473	carbohydrate derivative binding
GO:1901265	0.441	nucleoside phosphate binding
GO:0000166	0.433	nucleotide binding
GO:0046872	0.421	metal ion binding
GO:0017076	0.421	purine nucleotide binding
GO:0035639	0.418	purine ribonucleoside triphosphate binding
GO:0032555	0.414	purine ribonucleotide binding
GO:0046914	0.403	transition metal ion binding
GO:0008270	0.347	zinc ion binding
GO:0032561	0.330	guanyl ribonucleotide binding
GO:0031625	0.317	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0048518	0.993	positive regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0010468	0.989	regulation of gene expression
GO:0009987	0.988	cellular process
GO:0010604	0.983	positive regulation of macromolecule metabolic process
GO:0002376	0.979	immune system process
GO:0051239	0.979	regulation of multicellular organismal process
GO:0051707	0.979	response to other organism
GO:0006950	0.978	response to stress
GO:0001817	0.972	regulation of cytokine production
GO:0051240	0.970	positive regulation of multicellular organismal process
GO:0010628	0.969	positive regulation of gene expression
GO:0051716	0.958	cellular response to stimulus
GO:0001819	0.950	positive regulation of cytokine production
GO:0048583	0.948	regulation of response to stimulus
GO:0009615	0.948	response to virus
GO:0002831	0.938	regulation of response to biotic stimulus
GO:0007165	0.937	signal transduction
GO:0051607	0.934	defense response to virus
GO:0002684	0.930	positive regulation of immune system process
GO:0006955	0.927	immune response
GO:0032103	0.926	positive regulation of response to external stimulus
GO:0031349	0.926	positive regulation of defense response
GO:0050778	0.917	positive regulation of immune response
GO:0045087	0.906	innate immune response
GO:0002833	0.905	positive regulation of response to biotic stimulus
GO:0045088	0.905	regulation of innate immune response
GO:0045089	0.893	positive regulation of innate immune response
GO:0002253	0.890	activation of immune response
GO:0042221	0.885	response to chemical
GO:0010033	0.882	response to organic substance
GO:0032479	0.882	regulation of type I interferon production
GO:0051171	0.879	regulation of nitrogen compound metabolic process
GO:0002218	0.874	activation of innate immune response
GO:0080090	0.870	regulation of primary metabolic process
GO:0071704	0.851	organic substance metabolic process
GO:0002758	0.850	innate immune response-activating signaling pathway
GO:0009889	0.845	regulation of biosynthetic process
GO:0002221	0.837	pattern recognition receptor signaling pathway
GO:0002753	0.815	cytosolic pattern recognition receptor signaling pathway
GO:0031323	0.814	regulation of cellular metabolic process
GO:0032481	0.807	positive regulation of type I interferon production
GO:0032728	0.800	positive regulation of interferon-beta production
GO:0048522	0.754	positive regulation of cellular process
GO:0010556	0.752	regulation of macromolecule biosynthetic process
GO:0043331	0.748	response to dsRNA
GO:0043330	0.733	response to exogenous dsRNA
GO:0060759	0.730	regulation of response to cytokine stimulus
GO:0031326	0.714	regulation of cellular biosynthetic process
GO:0051252	0.714	regulation of RNA metabolic process
GO:0070887	0.698	cellular response to chemical stimulus
GO:2001141	0.689	regulation of RNA biosynthetic process
GO:0006355	0.675	regulation of DNA-templated transcription
GO:0032675	0.664	regulation of interleukin-6 production
GO:0044238	0.655	primary metabolic process
GO:0071310	0.651	cellular response to organic substance
GO:0032755	0.645	positive regulation of interleukin-6 production
GO:0060760	0.610	positive regulation of response to cytokine stimulus
GO:1903555	0.602	regulation of tumor necrosis factor superfamily cytokine production
GO:0006807	0.584	nitrogen compound metabolic process
GO:0043170	0.571	macromolecule metabolic process
GO:0051173	0.472	positive regulation of nitrogen compound metabolic process
GO:0065009	0.471	regulation of molecular function
GO:0032680	0.471	regulation of tumor necrosis factor production
GO:0031325	0.435	positive regulation of cellular metabolic process
GO:0048519	0.421	negative regulation of biological process
GO:0044093	0.364	positive regulation of molecular function
GO:0051246	0.357	regulation of protein metabolic process
GO:0051247	0.345	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.911	intracellular membrane-bounded organelle
GO:0016020	0.725	membrane
GO:0032991	0.425	protein-containing complex
GO:0005634	0.343	nucleus
GO:0043228	0.334	non-membrane-bounded organelle
GO:0043232	0.318	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.931	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.931	nucleoside-triphosphate phosphatase.
EC:3.6.4.13	0.870	RNA helicase.
RHEA:13065	0.477	ATP + H2O = ADP + H(+) + phosphate

[back to server]