StarFunc result for job id O95789

User Input

>input (1325 residues)
MKEPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQQPKTQESKLKIGGVSSVNERPIA
QQLNPGFQLSFASSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRC
ITRHSSPACLPPPPKKTCTNCSKDILNPKDVITTRFENSYPSKDFCSQSCLSSYELKKKP
VVTIYTKSISTKCSMCQKNADTRFEVKYQNVVHGLCSDACFSKFHSTNNLTMNCCENCGS
YCYSSSGPCQSQKVFSSTSVTAYKQNSAQIPPYALGKSLRPSAEMIETTNDSGKTELFCS
INCLSAYRVKTVTSSGVQVSCHSCKTSAIPQYHLAMSNGTIYSFCSSSCVVAFQNVFSKP
KGTNSSAVPLSQGQVVVSPPSSRSAVSIGGGNTSAVSPSSIRGSAAASLQPLAEQSQQVA
LTHTVVKLKCQHCNHLFATKPELLFYKGKMFLFCGKNCSDEYKKKNKVVAMCDYCKLQKI
IKETVRFSGVDKPFCSEVCKFLSARDFGERWGNYCKMCSYCSQTSPNLVENRLEGKLEEF
CCEDCMSKFTVLFYQMAKCDGCKRQGKLSESIKWRGNIKHFCNLFCVLEFCHQQIMNDCL
PQNKVNISKAKTAVTELPSARTDTTPVITSVMSLAKIPATLSTGNTNSVLKGAVTKEAAK
IIQDESTQEDAMKFPSSQSSQPSRLLKNKGISCKPVTQTKATSCKPHTQHKECQTDLPMP
NEKNDAELDSPPSKKKRLGFFQTYDTEYLKVGFIICPGSKESSPRPQCVICGEILSSENM
KPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQTA
ASKKPFSIAEELIKPYLVEMCSEVLGSSAGDKMKTIPLSNVTIQHRIDELSADIEDQLIQ
KVRESKWFALQIDESSEISNITLLLCYIRFIDYDCRDVKEELLFCIEMPTQITGFEIFEL
INKYIDSKSLNWKHCVGLCTDGAASMTGRYSGLKAKIQEVAMNTAAFTHCFIHRERLVAE
KLSPCLHKILLQSAQILSFIKSNALNSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLK
RLFELRHEIEIFLSQKHSDLAKYFHDEEWVGKLAYLSDIFSLINELNLSLQGTLTTFFNL
CNKIDVFKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLNMTDITRIIFEHLEGLSQVFSD
CFPPEQDLRSGNLWIIHPFMNHQNNNLTDFEEEKLTELSSDLGLQALFKSVSVTQFWINA
KTSYPELHERAMKFLLPFSTVYLCDAAFSALTESKQKNLLGSGPALRLAVTSLIPRIEKL
VKEKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95789	1.000	1.000	0.000	1325	1.000	1.000	O95789.pdb.gz	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
2	AFDB:O08815	0.042	0.046	8.549E-4	1206	0.101	0.111	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
3	AFDB:E9QAP7	0.044	0.051	3.595E-3	1042	0.082	0.105	E9QAP7.pdb.gz	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
4	AFDB:O00268	0.033	0.038	6.877E-3	1085	0.077	0.094	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
5	AFDB:F4K0Y5	0.068	0.075	1.378E-2	1165	0.109	0.124	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
6	AFDB:Q54DW4	0.070	0.070	1.583E-2	1350	0.105	0.103	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
7	AFDB:Q9VI93	0.048	0.059	2.190E-2	946	0.084	0.117	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
8	PDB:4kfzB	0.041	0.195	2.337E-2	148	0.020	0.176	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
9	AFDB:E5FYH1	0.075	0.065	2.892E-2	1653	0.135	0.108	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
10	AFDB:Q8NB66	0.066	0.045	3.646E-2	2214	0.114	0.068	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
11	AFDB:P27715	0.059	0.043	4.388E-2	2155	0.127	0.078	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
12	PDB:3idhA	0.078	0.168	8.957E-2	453	0.016	0.046	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
13	PDB:6dbiC	0.110	0.190	9.826E-2	622	0.040	0.085	6dbiC.pdb.gz	DNA melting initiates the RAG catalytic pathway.
14	PDB:2ivnA	0.081	0.196	1.183E-1	325	0.027	0.111	2ivnA.pdb.gz	An Archaeal Orthologue of the Universal Protein Kae1 is an Iron Metalloprotein which Exhibits Atypical DNA-Binding Properties and Apurinic-Endonuclease Activity in Vitro.
15	PDB:1b8tA	0.028	0.137	1.491E-1	192	0.030	0.208	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
16	PDB:5vm9C	0.051	0.080	2.062E-1	785	0.012	0.020	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
17	PDB:6oonA	0.043	0.063	2.263E-1	785	0.008	0.014	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
18	PDB:5weaA	0.055	0.082	2.370E-1	764	0.011	0.020	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
19	PDB:4alyA	0.057	0.192	2.852E-1	211	0.019	0.118	4alyA.pdb.gz
20	PDB:6humF	0.052	0.083	2.988E-1	611	0.038	0.083	6humF.pdb.gz	Structural adaptations of photosynthetic complex I enable ferredoxin-dependent electron transfer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95789	0.0	2739	1325	1.000	1.000	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
2	Q5VZL5	0.0	993	1548	0.383	0.328	ZMYM4_HUMAN Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4 PE=1 SV=1
3	Q6R2W3	2.17e-153	499	1325	0.202	0.202	SCND3_HUMAN SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCAND3 PE=1 SV=1
4	Q8TCP9	3.35e-110	361	573	0.152	0.353	F200A_HUMAN Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1
5	Q9UBW7	1.00e-104	365	1377	0.180	0.174	ZMYM2_HUMAN Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1
6	Q9CU65	3.11e-104	363	1376	0.172	0.166	ZMYM2_MOUSE Zinc finger MYM-type protein 2 OS=Mus musculus OX=10090 GN=Zmym2 PE=1 SV=3
7	B2RPU8	1.97e-100	340	756	0.155	0.272	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
8	Q8IZ13	4.91e-88	300	594	0.140	0.313	F200C_HUMAN Protein FAM200C OS=Homo sapiens OX=9606 GN=FAM200C PE=1 SV=1
9	A6NHN7	3.33e-83	301	1280	0.155	0.160	A6NHN7_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
10	Q14202	3.84e-83	301	1370	0.155	0.150	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
11	A6NHB5	4.14e-83	301	1372	0.155	0.149	A6NHB5_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
12	Q9JLM4	2.94e-81	295	1370	0.151	0.146	ZMYM3_MOUSE Zinc finger MYM-type protein 3 OS=Mus musculus OX=10090 GN=Zmym3 PE=1 SV=1
13	Q8CEW7	1.30e-75	265	583	0.113	0.257	Q8CEW7_MOUSE DUF4371 domain-containing protein OS=Mus musculus OX=10090 GN=Zbed5 PE=2 SV=1
14	Q99NI3	1.74e-38	158	936	0.110	0.156	GT2D2_MOUSE General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1
15	Q6EKJ0	2.00e-37	155	949	0.091	0.128	GTD2B_HUMAN General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
16	A0A494C1N8	2.20e-37	155	1116	0.091	0.108	A0A494C1N8_HUMAN GTF2I repeat domain containing 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
17	Q86UP8	4.93e-37	154	949	0.090	0.125	GTD2A_HUMAN General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3
18	A0A494C0I1	6.17e-37	154	1111	0.090	0.107	A0A494C0I1_HUMAN GTF2I repeat domain containing 2 OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=1
19	A6NL54	6.51e-33	137	497	0.058	0.155	A6NL54_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
20	Q9UJ78	4.99e-23	108	669	0.051	0.102	ZMYM5_HUMAN Zinc finger MYM-type protein 5 OS=Homo sapiens OX=9606 GN=ZMYM5 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05699 Dimer_Tnp_hAT	2.8e+02	12.7	hAT family C-terminal dimerisation region
2	PF14291 DUF4371	8.3e-05	33.8	Domain of unknown function (DUF4371)
3	PF02892 zf-BED	55	15.2	BED zinc finger
4	PF06467 zf-FCS	1.6e-35	132.0	MYM-type Zinc finger with FCS sequence motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281928	0.693	Mediator of RNA polymerase II transcription subunit 13-like
2	9606.ENSP00000303777	0.638	Testis-expressed protein 13B
3	9606.ENSP00000322570	0.638	DNA polymerase epsilon catalytic subunit A
4	9606.ENSP00000391596	0.522	N-acetylglucosamine-6-phosphate deacetylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0050789	0.966	regulation of biological process
GO:0007010	0.900	cytoskeleton organization
GO:0022604	0.830	regulation of cell morphogenesis
GO:0050794	0.341	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.974	cytoplasm
GO:0005829	0.884	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]