StarFunc result for job id O95803

User Input

>input (873 residues)
MSFIMKLHRHFQRTVILLATFCMVSIIISAYYLYSGYKQENELSETASEVDCGDLQHLPY
QLMEVKAMKLFDASRTDPTVLVFVESQYSSLGQDIIMILESSRFQYHIEIAPGKGDLPVL
IDKMKGKYILIIYENILKYINMDSWNRSLLDKYCVEYGVGVIGFHKTSEKSVQSFQLKGF
PFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQINHSAYQPVIFAKVKT
PENLSPSISKGAFYATIIHDLGLHDGIQRVLFGNNLNFWLHKLIFIDAISFLSGKRLTLS
LDRYILVDIDDIFVGKEGTRMNTNDVKALLDTQNLLRAQITNFTFNLGFSGKFYHTGTEE
EDEGDDCLLGSVDEFWWFPHMWSHMQPHLFHNESSLVEQMILNKKFALEHGIPTDMGYAV
APHHSGVYPVHVQLYEAWKKVWNIKITSTEEYPHLKPARYRRGFIHKNIMVLPRQTCGLF
THTIFYKEYPGGPKELDKSIQGGELFFTVVLNPISIFMTHLSNYGNDRLGLYTFVNLANF
VKSWTNLRLQTLPPVQLAHKYFELFPDQKDPLWQNPCDDKRHRDIWSKEKTCDRLPKFLV
IGPQKTGTTALYLFLVMHPSILSNSPSPKTFEEVQFFNRNNYHRGIDWYMDFFPVPSNVT
TDFLFEKSANYFHSEEAPKRAASLVPKAKIITILIDPSDRAYSWYQHQRSHEDPAALKFS
FYEVISAGPRAPSELRALQKRCLVPGWYASHIERWLVYFPPFQLLIIDGQQLRTDPATVM
DEVQKFLGVLPHYNYSEALTFDSHKGFWCQLLEEGKTKCLGKSKGRKYPPMDSDSRTFLS
SYYRDHNVELSKLLHKLGQPLPSWLRQELQKVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IR84	0.902	0.888	0.000	886	0.683	0.673	A0A0R4IR84.pdb.gz	A0A0R4IR84_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=fj47c03 PE=1 SV=1
2	AFDB:A0A2R8RQ45	0.901	0.876	0.000	898	0.630	0.612	A0A2R8RQ45.pdb.gz
3	AFDB:O95803	1.000	1.000	0.000	873	1.000	1.000	O95803.pdb.gz	NDST3_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=NDST3 PE=1 SV=1
4	AFDB:P52848	0.935	0.926	0.000	882	0.707	0.700	P52848.pdb.gz	NDST1_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=NDST1 PE=1 SV=1
5	AFDB:P52849	0.901	0.891	0.000	883	0.654	0.647	P52849.pdb.gz	NDST2_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=NDST2 PE=1 SV=1
6	AFDB:Q9EQW8	0.949	0.950	0.000	872	0.809	0.810	Q9EQW8.pdb.gz	NDST4_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 OS=Mus musculus OX=10090 GN=Ndst4 PE=2 SV=2
7	AFDB:Q9V3L1	0.888	0.742	0.000	1048	0.549	0.457	Q9V3L1.pdb.gz	NDST_DROME Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase OS=Drosophila melanogaster OX=7227 GN=sfl PE=1 SV=1
8	AFDB:Q4TTA0	0.279	0.802	6.123E-19	291	0.099	0.296	Q4TTA0.pdb.gz	Q4TTA0_CAEEL Sulfotransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hst-3.2 PE=4 SV=1
9	AFDB:A0MGZ3	0.269	0.731	6.468E-19	309	0.092	0.259	A0MGZ3.pdb.gz	A0MGZ3_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st7 PE=2 SV=1
10	AFDB:Q673U1	0.271	0.627	6.468E-19	367	0.101	0.240	Q673U1.pdb.gz	HS3S2_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Hs3st2 PE=2 SV=2
11	PDB:1zrhA	0.272	0.857	1.238E-18	263	0.092	0.304	1zrhA.pdb.gz	Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
12	PDB:7scdA	0.272	0.615	1.053E-17	371	0.105	0.248	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate
13	PDB:4wioA	0.158	0.238	1.149E-4	525	0.054	0.090	4wioA.pdb.gz	Active site coupling in Plasmodium falciparum GMP synthetase is triggered by domain rotation.
14	PDB:1gpmA	0.143	0.233	2.765E-4	501	0.050	0.088	1gpmA.pdb.gz	The crystal structure of GMP synthetase reveals a novel catalytic triad and is a structural paradigm for two enzyme families.
15	PDB:3uowB	0.120	0.198	4.060E-4	477	0.046	0.084	3uowB.pdb.gz	Crystal Structure of PF10_0123, a GMP Synthetase from Plasmodium Falciparum
16	PDB:3mgbA	0.181	0.427	2.351E-3	286	0.046	0.140	3mgbA.pdb.gz	Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
17	PDB:2abwB	0.167	0.515	4.070E-3	226	0.031	0.119	2abwB.pdb.gz
18	PDB:3mgcB	0.138	0.410	4.070E-3	227	0.036	0.137	3mgcB.pdb.gz	Crystal structures of the glycopeptide sulfotransferase Teg12 in a complex with the teicoplanin aglycone.
19	PDB:5mekA	0.158	0.354	4.070E-3	322	0.068	0.183	5mekA.pdb.gz	Structural and biochemical studies of sulphotransferase 18 from Arabidopsis thaliana explain its substrate specificity and reaction mechanism.
20	PDB:3p0bA	0.189	0.298	4.798E-3	511	0.050	0.086	3p0bA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IR84	0.0	1263	886	0.678	0.668	A0A0R4IR84_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=fj47c03 PE=1 SV=1
2	E7F0G2	0.0	1180	869	0.628	0.631	E7F0G2_DANRE [heparan sulfate]-glucosamine N-sulfotransferase OS=Danio rerio OX=7955 GN=ndst1a PE=3 SV=1
3	O95803	0.0	1819	873	1.000	1.000	NDST3_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=NDST3 PE=1 SV=1
4	P52848	0.0	1314	882	0.711	0.704	NDST1_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=NDST1 PE=1 SV=1
5	P52849	0.0	1239	883	0.636	0.629	NDST2_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=NDST2 PE=1 SV=1
6	P52850	0.0	1228	883	0.645	0.638	NDST2_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Ndst2 PE=1 SV=1
7	Q02353	0.0	1319	882	0.711	0.704	NDST1_RAT Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Rattus norvegicus OX=10116 GN=Ndst1 PE=1 SV=1
8	Q3UHN9	0.0	1316	882	0.710	0.703	NDST1_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Mus musculus OX=10090 GN=Ndst1 PE=1 SV=2
9	Q9EQH7	0.0	1718	873	0.934	0.934	NDST3_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Mus musculus OX=10090 GN=Ndst3 PE=2 SV=2
10	Q9EQW8	0.0	1523	872	0.811	0.812	NDST4_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 OS=Mus musculus OX=10090 GN=Ndst4 PE=2 SV=2
11	Q9V3L1	0.0	989	1048	0.557	0.464	NDST_DROME Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase OS=Drosophila melanogaster OX=7227 GN=sfl PE=1 SV=1
12	Q4TTA0	2.77e-36	140	291	0.107	0.320	Q4TTA0_CAEEL Sulfotransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hst-3.2 PE=4 SV=1
13	A0MGZ2	3.07e-34	136	334	0.102	0.266	A0MGZ2_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st6 PE=2 SV=1
14	Q9VWJ7	6.32e-33	134	384	0.104	0.237	Q9VWJ7_DROME Heparan sulfate 3-O sulfotransferase-B, isoform A OS=Drosophila melanogaster OX=7227 GN=Hs3st-B PE=2 SV=1
15	A0MGZ3	2.62e-32	130	309	0.109	0.307	A0MGZ3_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st7 PE=2 SV=1
16	Q9QZS6	4.22e-32	131	390	0.102	0.228	HS3SB_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Mus musculus OX=10090 GN=Hs3st3b1 PE=2 SV=2
17	Q9Y663	4.77e-32	131	406	0.099	0.212	HS3SA_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Homo sapiens OX=9606 GN=HS3ST3A1 PE=1 SV=1
18	Q673U1	5.24e-32	130	367	0.099	0.234	HS3S2_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Hs3st2 PE=2 SV=2
19	Q80W66	5.24e-32	130	367	0.099	0.234	HS3S2_RAT Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Rattus norvegicus OX=10116 GN=Hs3st2 PE=1 SV=1
20	Q9Y662	6.93e-32	130	390	0.100	0.223	HS3SB_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Homo sapiens OX=9606 GN=HS3ST3B1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12062 HSNSD	5.2e-225	758.8	heparan sulfate-N-deacetylase
2	PF00685 Sulfotransfer_1	1.1e-39	148.2	Sulfotransferase domain
3	PF13469 Sulfotransfer_3	1.9e-05	36.7	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296499

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359864	0.952	Glypican-4
2	9606.ENSP00000366267	0.950	Glypican-5
3	9606.ENSP00000377836	0.948	Glypican-3
4	9606.ENSP00000292377	0.945	Glypican-2
5	9606.ENSP00000264039	0.944	Glypican-1
6	9606.ENSP00000366246	0.944	Glypican-6
7	9606.ENSP00000307046	0.940	Syndecan-2
8	9606.ENSP00000344468	0.937	Syndecan-3
9	9606.ENSP00000363827	0.934	Basement membrane-specific heparan sulfate proteoglycan core protein
10	9606.ENSP00000361818	0.931	Syndecan-4
11	9606.ENSP00000368678	0.928	Agrin
12	9606.ENSP00000370542	0.923	Syndecan-1
13	9606.ENSP00000261858	0.795	D-glucuronyl C5-epimerase
14	9606.ENSP00000359581	0.773	Heparan sulfate 2-O-sulfotransferase 1
15	9606.ENSP00000359579	0.746	Heparan sulfate 2-O-sulfotransferase 1
16	9606.ENSP00000259241	0.701	Heparan-sulfate 6-O-sulfotransferase 1
17	9606.ENSP00000220562	0.697	Exostosin-like 3
18	9606.ENSP00000379032	0.688	Exostosin-2
19	9606.ENSP00000367446	0.678	Exostosin-1
20	9606.ENSP00000429473	0.667	Heparan-sulfate 6-O-sulfotransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019213	1.000	deacetylase activity
GO:0015016	1.000	[heparan sulfate]-glucosamine N-sulfotransferase activity
GO:0016811	0.994	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0052689	0.969	carboxylic ester hydrolase activity
GO:0050119	0.919	N-acetylglucosamine deacetylase activity
GO:0005515	0.805	protein binding
GO:0102140	0.554	heparan sulfate N-deacetylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009100	0.996	glycoprotein metabolic process
GO:1901137	0.995	carbohydrate derivative biosynthetic process
GO:1901566	0.995	organonitrogen compound biosynthetic process
GO:0034645	0.995	cellular macromolecule biosynthetic process
GO:0009101	0.994	glycoprotein biosynthetic process
GO:0006029	0.988	proteoglycan metabolic process
GO:0044272	0.986	sulfur compound biosynthetic process
GO:0030166	0.982	proteoglycan biosynthetic process
GO:0015012	0.956	heparan sulfate proteoglycan biosynthetic process
GO:0005975	0.570	carbohydrate metabolic process
GO:0016051	0.502	carbohydrate biosynthetic process
GO:0034637	0.327	cellular carbohydrate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.988	membrane
GO:0031090	0.911	organelle membrane
GO:0000139	0.897	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	1.000	Hydrolases.
RHEA:21980	1.000	3'-phosphoadenylyl sulfate + alpha-D-glucosaminyl-[heparan sulfate](n) = adenosine 3',5'-bisphosphate + 2 H(+) + N-sulfo-alpha-D-glucosaminyl-[heparan sulfate](n)
EC:2.8.2.8	1.000	[heparan sulfate]-glucosamine N-sulfotransferase.
EC:3.5.1.-	0.994	In linear amides.
EC:3.1.1.-	0.969	Carboxylic ester hydrolases.
RHEA:20593	0.919	H2O + N-acetyl-D-glucosamine = acetate + D-glucosamine
EC:3.5.1.33	0.919	N-acetylglucosamine deacetylase.

[back to server]