StarFunc result for job id O95813

User Input

>input (267 residues)
MHLLLFQLLVLLPLGKTTRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAV
PHLVATSPAGEGQRQREKMLSRFGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPIDGMK
MEKSPLREEAKKFWHHFMFRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVV
VQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQ
CKVKTEHEDGHILHAGSQDSFIPGVSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95813	1.000	1.000	8.663E-44	267	1.000	1.000	O95813.pdb.gz	CER1_HUMAN Cerberus OS=Homo sapiens OX=9606 GN=CER1 PE=1 SV=1
2	AFDB:O55233	0.407	0.401	6.015E-26	272	0.685	0.673	O55233.pdb.gz	CER1_MOUSE Cerberus OS=Mus musculus OX=10090 GN=Cer1 PE=1 SV=1
3	AFDB:P70041	0.326	0.323	2.834E-14	270	0.273	0.270	P70041.pdb.gz	CER1_XENLA Cerberus OS=Xenopus laevis OX=8355 GN=cer1 PE=1 SV=1
4	AFDB:A8E7M9	0.320	0.349	4.779E-10	243	0.217	0.239	A8E7M9.pdb.gz
5	AFDB:Q800X4	0.305	0.369	6.711E-10	217	0.199	0.244	Q800X4.pdb.gz	DAND5_XENLA DAN domain family member 5 OS=Xenopus laevis OX=8355 GN=dand5 PE=1 SV=1
6	AFDB:Q76LW6	0.304	0.430	1.425E-8	185	0.187	0.270	Q76LW6.pdb.gz	DAND5_MOUSE DAN domain family member 5 OS=Mus musculus OX=10090 GN=Dand5 PE=2 SV=1
7	PDB:5hk5F	0.272	0.525	1.412E-6	129	0.105	0.217	5hk5F.pdb.gz
8	PDB:2k8pA	0.231	0.305	1.733E-4	189	0.124	0.175	2k8pA.pdb.gz
9	PDB:4my2A	0.264	0.152	1.122E-3	474	0.075	0.042	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
10	PDB:1hcnB	0.275	0.576	2.935E-3	110	0.064	0.155	1hcnB.pdb.gz
11	PDB:4mqwB	0.248	0.525	5.469E-3	109	0.067	0.165	4mqwB.pdb.gz
12	PDB:5ntuA	0.211	0.186	3.963E-2	308	0.082	0.071	5ntuA.pdb.gz
13	PDB:7t9iB	0.288	0.622	1.161E-1	109	0.056	0.138	7t9iB.pdb.gz
14	PDB:5hlyA	0.212	0.191	2.714E-1	299	0.075	0.067	5hlyA.pdb.gz
15	AFDB:A0A0G2L5S8	0.151	0.067	3.982E-1	767	0.120	0.042	A0A0G2L5S8.pdb.gz
16	PDB:1m4uA	0.178	0.226	4.033E-1	199	0.127	0.171	1m4uA.pdb.gz
17	PDB:1wq8A	0.198	0.409	7.102E-1	100	0.071	0.190	1wq8A.pdb.gz
18	AFDB:Q6FSJ1	0.089	0.047	1.942	577	0.124	0.057	Q6FSJ1.pdb.gz	Q6FSJ1_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP6 PE=4 SV=1
19	AFDB:A0A2R8QRP8	0.110	0.045	5.082	811	0.165	0.054	A0A2R8QRP8.pdb.gz
20	AFDB:Q9LYG9	0.128	0.056	5.691	734	0.071	0.026	Q9LYG9.pdb.gz	MSL10_ARATH Mechanosensitive ion channel protein 10 OS=Arabidopsis thaliana OX=3702 GN=MSL10 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95813	0.0	550	267	1.000	1.000	CER1_HUMAN Cerberus OS=Homo sapiens OX=9606 GN=CER1 PE=1 SV=1
2	O55233	1.04e-120	347	272	0.637	0.625	CER1_MOUSE Cerberus OS=Mus musculus OX=10090 GN=Cer1 PE=1 SV=1
3	Q9PWB0	5.97e-57	185	272	0.367	0.360	CER1_CHICK Cerberus OS=Gallus gallus OX=9031 GN=CER1 PE=2 SV=1
4	Q9PUK2	2.18e-56	184	272	0.363	0.357	Q9PUK2_CHICK Caronte OS=Gallus gallus OX=9031 GN=CAR PE=2 SV=1
5	P70041	1.73e-27	108	270	0.217	0.215	CER1_XENLA Cerberus OS=Xenopus laevis OX=8355 GN=cer1 PE=1 SV=1
6	Q76C29	1.11e-15	76.3	243	0.184	0.202	Q76C29_DANRE DAN domain family, member 5 precursor OS=Danio rerio OX=7955 GN=charon PE=2 SV=1
7	Q76LW6	4.13e-14	70.9	185	0.142	0.205	DAND5_MOUSE DAN domain family member 5 OS=Mus musculus OX=10090 GN=Dand5 PE=2 SV=1
8	R0KDQ4	7.37e-14	70.1	184	0.135	0.196	R0KDQ4_ANAPL Gremlin 1, DAN family BMP antagonist (Fragment) OS=Anas platyrhynchos OX=8839 GN=GREM1 PE=3 SV=1
9	Q566Z5	1.13e-13	69.3	166	0.120	0.193	Q566Z5_DANRE Gremlin OS=Danio rerio OX=7955 GN=grem2 PE=2 SV=1
10	O60565	1.48e-13	69.3	184	0.135	0.196	GREM1_HUMAN Gremlin-1 OS=Homo sapiens OX=9606 GN=GREM1 PE=1 SV=1
11	O35793	1.51e-13	69.3	184	0.135	0.196	GREM1_RAT Gremlin-1 OS=Rattus norvegicus OX=10116 GN=Grem1 PE=1 SV=1
12	O70326	1.62e-13	69.3	184	0.135	0.196	GREM1_MOUSE Gremlin-1 OS=Mus musculus OX=10090 GN=Grem1 PE=2 SV=1
13	O73754	1.04e-12	67.0	182	0.127	0.187	GREM1_XENLA Gremlin-1 OS=Xenopus laevis OX=8355 GN=grem1 PE=2 SV=1
14	O88273	8.95e-12	63.9	168	0.124	0.196	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
15	Q9H772	3.78e-11	62.4	168	0.116	0.185	GREM2_HUMAN Gremlin-2 OS=Homo sapiens OX=9606 GN=GREM2 PE=1 SV=1
16	Q800X4	1.26e-09	58.9	217	0.146	0.180	DAND5_XENLA DAN domain family member 5 OS=Xenopus laevis OX=8355 GN=dand5 PE=1 SV=1
17	Q6NZ13	4.05e-05	45.4	183	0.124	0.180	NBL1_DANRE Neuroblastoma suppressor of tumorigenicity 1 OS=Danio rerio OX=7955 GN=nbl1 PE=2 SV=1
18	Q90YC9	4.90e-05	45.1	177	0.101	0.153	NBL1_CHICK Neuroblastoma suppressor of tumorigenicity 1 OS=Gallus gallus OX=9031 GN=NBL1 PE=2 SV=2
19	P41271	5.12e-05	45.1	181	0.124	0.182	NBL1_HUMAN Neuroblastoma suppressor of tumorigenicity 1 OS=Homo sapiens OX=9606 GN=NBL1 PE=1 SV=2
20	Q61477	6.22e-05	44.7	178	0.139	0.208	NBL1_MOUSE Neuroblastoma suppressor of tumorigenicity 1 OS=Mus musculus OX=10090 GN=Nbl1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	0.016	26.8	Cystine-knot domain
2	PF03045 DAN	8.2e-26	101.6	DAN domain
3	PF01684 ET	1.4e+02	14.3	ET module
4	PF05463 Sclerostin	2.7	19.2	Sclerostin (SOST)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370297

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296145	0.947	Teratocarcinoma-derived growth factor 1
2	9606.ENSP00000245451	0.946	Bone morphogenetic protein 4
3	9606.ENSP00000368104	0.930	Bone morphogenetic protein 2
4	9606.ENSP00000363708	0.921	Bone morphogenetic protein receptor type-2
5	9606.ENSP00000442656	0.921	Activin receptor type-1B
6	9606.ENSP00000361107	0.912	Bone morphogenetic protein receptor type-1A
7	9606.ENSP00000401907	0.911	Bone morphogenetic protein receptor type-1B
8	9606.ENSP00000259216	0.910	Cryptic protein
9	9606.ENSP00000243349	0.909	Activin receptor type-1C
10	9606.ENSP00000340361	0.908	Activin receptor type-2B
11	9606.ENSP00000364683	0.907	BMP and activin membrane-bound inhibitor homolog
12	9606.ENSP00000241416	0.904	Activin receptor type-2A
13	9606.ENSP00000308219	0.900	RGM domain family member B
14	9606.ENSP00000337014	0.900	Hemojuvelin
15	9606.ENSP00000452126	0.900	Repulsive guidance molecule A
16	9606.ENSP00000287139	0.859	Nodal homolog
17	9606.ENSP00000225512	0.755	Proto-oncogene Wnt-3
18	9606.ENSP00000272134	0.717	Left-right determination factor 1
19	9606.ENSP00000284523	0.705	Protein Wnt-3a
20	9606.ENSP00000264634	0.675	Protein Wnt-5a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0036122	1.000	BMP binding
GO:0048018	1.000	receptor ligand activity
GO:0016015	0.913	morphogen activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.988	multicellular organism development
GO:0048523	0.985	negative regulation of cellular process
GO:0009966	0.985	regulation of signal transduction
GO:0009987	0.981	cellular process
GO:0030514	0.979	negative regulation of BMP signaling pathway
GO:0048731	0.962	system development
GO:0048513	0.960	animal organ development
GO:0032925	0.955	regulation of activin receptor signaling pathway
GO:0071692	0.925	protein localization to extracellular region
GO:0050793	0.919	regulation of developmental process
GO:0009888	0.909	tissue development
GO:0051093	0.880	negative regulation of developmental process
GO:0007389	0.877	pattern specification process
GO:0003002	0.857	regionalization
GO:0019222	0.806	regulation of metabolic process
GO:0060255	0.789	regulation of macromolecule metabolic process
GO:0050896	0.765	response to stimulus
GO:0048518	0.753	positive regulation of biological process
GO:0010468	0.664	regulation of gene expression
GO:0045185	0.648	maintenance of protein location
GO:0051716	0.576	cellular response to stimulus
GO:0009799	0.539	specification of symmetry
GO:0010604	0.507	positive regulation of macromolecule metabolic process
GO:0009855	0.502	determination of bilateral symmetry
GO:0007399	0.499	nervous system development
GO:0051239	0.438	regulation of multicellular organismal process
GO:0007165	0.380	signal transduction
GO:0009653	0.378	anatomical structure morphogenesis
GO:0048522	0.313	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.939	extracellular space
GO:0005737	0.456	cytoplasm
GO:0071944	0.436	cell periphery
GO:0043229	0.383	intracellular organelle
GO:0016020	0.382	membrane
GO:0043231	0.370	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]