StarFunc result for job id O95816

User Input

>input (211 residues)
MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEV
VNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IENSDKAIKLLEHSKGAGSKTLQQNAESRFN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95816	1.000	1.000	5.223E-29	211	1.000	1.000	O95816.pdb.gz	BAG2_HUMAN BAG family molecular chaperone regulator 2 OS=Homo sapiens OX=9606 GN=BAG2 PE=1 SV=1
2	AFDB:O61980	0.684	0.343	1.928E-12	458	0.332	0.153	O61980.pdb.gz	O61980_CAEEL BAG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-23 PE=1 SV=1
3	AFDB:Q4Q8B8	0.205	0.171	4.053E-1	266	0.114	0.090	Q4Q8B8.pdb.gz	Q4Q8B8_LEIMA Qa-SNARE protein OS=Leishmania major OX=5664 GN=LMJF_28_1480 PE=3 SV=1
4	PDB:5oc0A	0.172	0.195	7.203E-1	174	0.090	0.109	5oc0A.pdb.gz	Scavenging of superoxide by a membrane-bound superoxide oxidase.
5	AFDB:Q15386	0.208	0.054	8.931E-1	1083	0.114	0.022	Q15386.pdb.gz	UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens OX=9606 GN=UBE3C PE=1 SV=3
6	AFDB:Q56X46	0.146	0.062	1.058	673	0.142	0.045	Q56X46.pdb.gz	MSL2_ARATH Mechanosensitive ion channel protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MSL2 PE=2 SV=1
7	PDB:3bq3A	0.145	0.132	1.266	250	0.133	0.112	3bq3A.pdb.gz
8	AFDB:Q38F16	0.193	0.174	1.484	235	0.156	0.140	Q38F16.pdb.gz	Q38F16_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3910 PE=4 SV=1
9	AFDB:Q57ZJ9	0.282	0.044	1.484	1642	0.095	0.012	Q57ZJ9.pdb.gz	Q57ZJ9_TRYB2 SAM domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.750 PE=4 SV=1
10	PDB:6tuyA	0.192	0.074	1.587	667	0.128	0.040	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
11	AFDB:Q9VGX0	0.140	0.122	1.860	261	0.090	0.073	Q9VGX0.pdb.gz	Q9VGX0_DROME Desiccate OS=Drosophila melanogaster OX=7227 GN=Desi PE=2 SV=1
12	PDB:7zu0E	0.209	0.136	1.880	343	0.100	0.061	7zu0E.pdb.gz
13	PDB:4by9F	0.111	0.081	2.104	366	0.076	0.044	4by9F.pdb.gz	The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
14	PDB:7d5sB2	0.190	0.062	2.104	851	0.152	0.038	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
15	AFDB:Q6S003	0.206	0.031	2.331	1873	0.128	0.014	Q6S003.pdb.gz	KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum OX=44689 GN=kif8 PE=2 SV=1
16	PDB:3ctwB	0.137	0.207	2.356	120	0.062	0.108	3ctwB.pdb.gz
17	AFDB:X1WCA2	0.234	0.086	2.466	621	0.133	0.045	X1WCA2.pdb.gz	X1WCA2_DANRE Ecto-NOX disulfide-thiol exchanger 1 OS=Danio rerio OX=7955 GN=enox1 PE=4 SV=2
18	PDB:7yqcA	0.135	0.142	2.493	198	0.128	0.136	7yqcA.pdb.gz
19	PDB:3hajA	0.212	0.168	2.637	286	0.100	0.073	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
20	PDB:2q40A	0.166	0.112	2.953	343	0.095	0.058	2q40A.pdb.gz	Ensemble refinement of protein crystal structures: validation and application.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95816	1.28e-154	428	211	1.000	1.000	BAG2_HUMAN BAG family molecular chaperone regulator 2 OS=Homo sapiens OX=9606 GN=BAG2 PE=1 SV=1
2	Q91YN9	1.06e-142	398	210	0.934	0.938	BAG2_MOUSE BAG family molecular chaperone regulator 2 OS=Mus musculus OX=10090 GN=Bag2 PE=1 SV=1
3	O61980	8.07e-30	116	458	0.327	0.151	O61980_CAEEL BAG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-23 PE=1 SV=1
4	Q80U30	2.0	32.0	1036	0.095	0.019	CL16A_MOUSE Protein CLEC16A OS=Mus musculus OX=10090 GN=Clec16a PE=1 SV=2
5	Q9VDE6	2.7	31.2	766	0.090	0.025	EXOC6_DROME Exocyst complex component 6 OS=Drosophila melanogaster OX=7227 GN=Sec15 PE=1 SV=1
6	Q15643	5.2	30.4	1979	0.213	0.023	TRIPB_HUMAN Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=3
7	H0YJ97	5.6	30.4	1695	0.213	0.027	H0YJ97_HUMAN Thyroid hormone receptor interactor 11 (Fragment) OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=1
8	P0ACT6	8.6	29.3	196	0.081	0.087	UIDR_ECOLI HTH-type transcriptional regulator UidR OS=Escherichia coli (strain K12) OX=83333 GN=uidR PE=1 SV=1
9	Q9UBV8	9.1	29.3	284	0.076	0.056	PEF1_HUMAN Peflin OS=Homo sapiens OX=9606 GN=PEF1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14733 ACDC	8.1e+02	11.7	AP2-coincident C-terminal
2	PF14535 AMP-binding_C_2	5.1e+02	12.4	AMP-binding enzyme C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302961	0.999	Heat shock protein family A member 4
2	9606.ENSP00000432083	0.999	Heat shock cognate 71 kDa protein
3	9606.ENSP00000364802	0.993	Heat shock 70 kDa protein 1A
4	9606.ENSP00000364801	0.989	Heat shock protein family A member 1B
5	9606.ENSP00000364805	0.980	Heat shock 70 kDa protein 1-like
6	9606.ENSP00000420514	0.980	BAG family molecular chaperone regulator 1
7	9606.ENSP00000378199	0.973	Heat shock-related 70 kDa protein 2
8	9606.ENSP00000297185	0.961	Stress-70 protein, mitochondrial
9	9606.ENSP00000255631	0.947	Hsp70-binding protein 1
10	9606.ENSP00000324173	0.947	78 kDa glucose-regulated protein
11	9606.ENSP00000310219	0.942	Heat shock 70 kDa protein 6
12	9606.ENSP00000219548	0.941	E3 ubiquitin-protein ligase CHIP
13	9606.ENSP00000285667	0.940	Heat shock 70 kDa protein 13
14	9606.ENSP00000318687	0.938	Heat shock protein 105 kDa
15	9606.ENSP00000254963	0.936	Heat shock protein family A member 12B
16	9606.ENSP00000367623	0.935	Heat shock 70 kDa protein 14
17	9606.ENSP00000358211	0.930	Heat shock protein family A member 12A
18	9606.ENSP00000296464	0.929	Heat shock 70 kDa protein 4L
19	9606.ENSP00000358081	0.924	BAG family molecular chaperone regulator 3
20	9606.ENSP00000338814	0.828	BAG family molecular chaperone regulator 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.994	organic cyclic compound binding
GO:1901363	0.993	heterocyclic compound binding
GO:0042802	0.983	identical protein binding
GO:0000166	0.980	nucleotide binding
GO:0060590	0.960	ATPase regulator activity
GO:0051087	0.953	chaperone binding
GO:0000774	0.936	adenyl-nucleotide exchange factor activity
GO:0044325	0.935	transmembrane transporter binding
GO:0019899	0.584	enzyme binding
GO:0031072	0.348	heat shock protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0080090	0.990	regulation of primary metabolic process
GO:0010604	0.988	positive regulation of macromolecule metabolic process
GO:0009892	0.987	negative regulation of metabolic process
GO:0030162	0.977	regulation of proteolysis
GO:0051248	0.977	negative regulation of protein metabolic process
GO:0031396	0.975	regulation of protein ubiquitination
GO:0051173	0.974	positive regulation of nitrogen compound metabolic process
GO:0051247	0.949	positive regulation of protein metabolic process
GO:0006457	0.939	protein folding
GO:0065008	0.927	regulation of biological quality
GO:0031400	0.923	negative regulation of protein modification process
GO:0045862	0.904	positive regulation of proteolysis
GO:0050794	0.884	regulation of cellular process
GO:0031397	0.867	negative regulation of protein ubiquitination
GO:0044238	0.861	primary metabolic process
GO:0071704	0.860	organic substance metabolic process
GO:0006807	0.840	nitrogen compound metabolic process
GO:0043170	0.839	macromolecule metabolic process
GO:0031647	0.813	regulation of protein stability
GO:0010468	0.783	regulation of gene expression
GO:0065009	0.729	regulation of molecular function
GO:1901564	0.727	organonitrogen compound metabolic process
GO:0019538	0.592	protein metabolic process
GO:0050790	0.476	regulation of catalytic activity
GO:0031323	0.461	regulation of cellular metabolic process
GO:0050821	0.449	protein stabilization
GO:0048522	0.398	positive regulation of cellular process
GO:0051338	0.396	regulation of transferase activity
GO:0009894	0.353	regulation of catabolic process
GO:0048523	0.338	negative regulation of cellular process
GO:0042176	0.317	regulation of protein catabolic process
GO:0043393	0.309	regulation of protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.997	cytosol
GO:0043229	0.996	intracellular organelle
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0140535	0.983	intracellular protein-containing complex
GO:0101031	0.912	chaperone complex
GO:0005856	0.889	cytoskeleton
GO:0005634	0.883	nucleus
GO:0070013	0.818	intracellular organelle lumen
GO:0005654	0.576	nucleoplasm
GO:0099512	0.549	supramolecular fiber
GO:0015630	0.512	microtubule cytoskeleton
GO:0042995	0.471	cell projection
GO:0120025	0.448	plasma membrane bounded cell projection
GO:0099513	0.412	polymeric cytoskeletal fiber
GO:0043005	0.348	neuron projection
GO:0005874	0.348	microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]