StarFunc result for job id O95817

User Input

>input (575 residues)
MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPK
ETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQ
RFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCS
SSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEY
QTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSSTPLHSPSPIRVHTVVD
RPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSE
KVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP
GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQAR
RDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAG
NAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95817	0.999	0.999	2.703E-76	575	1.000	1.000	O95817.pdb.gz	BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3
2	AFDB:Q9JLV1	0.425	0.424	1.399E-62	577	0.850	0.847	Q9JLV1.pdb.gz	BAG3_MOUSE BAG family molecular chaperone regulator 3 OS=Mus musculus OX=10090 GN=Bag3 PE=1 SV=2
3	AFDB:F1Q9J0	0.166	0.195	4.976E-22	480	0.313	0.375	F1Q9J0.pdb.gz
4	AFDB:Q5XIR5	0.153	0.189	1.185E-10	457	0.217	0.274	Q5XIR5.pdb.gz	Q5XIR5_RAT BAG cochaperone 4 OS=Rattus norvegicus OX=10116 GN=Bag4 PE=1 SV=1
5	AFDB:A0A024QZV9	0.074	0.056	7.575E-4	834	0.144	0.100	A0A024QZV9.pdb.gz
6	AFDB:O82345	0.117	0.069	1.216E-3	1043	0.197	0.108	O82345.pdb.gz	BAG6_ARATH BAG family molecular chaperone regulator 6 OS=Arabidopsis thaliana OX=3702 GN=BAG6 PE=1 SV=1
7	AFDB:Q86SQ0	0.075	0.039	1.452E-3	1253	0.130	0.060	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
8	AFDB:Q63767	0.056	0.041	2.782E-3	968	0.170	0.101	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
9	AFDB:M0R4F8	0.078	0.037	3.967E-3	1577	0.144	0.053	M0R4F8.pdb.gz	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
10	AFDB:Q8K1N2	0.077	0.041	4.465E-3	1249	0.155	0.071	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
11	PDB:1nmvA	0.065	0.185	9.538E-2	163	0.024	0.086	1nmvA.pdb.gz
12	PDB:1yw5A	0.053	0.170	1.360E-1	177	0.014	0.045	1yw5A.pdb.gz
13	PDB:5ynxA	0.100	0.362	2.457E-1	117	0.024	0.120	5ynxA.pdb.gz
14	PDB:2jmhA	0.091	0.273	2.765E-1	117	0.026	0.128	2jmhA.pdb.gz
15	PDB:7kkfA	0.054	0.187	3.503E-1	162	0.014	0.049	7kkfA.pdb.gz
16	PDB:4adnA	0.087	0.197	6.328E-1	213	0.019	0.052	4adnA.pdb.gz	Structure and Function of Fusb: An Elongation Factor G-Binding Fusidic Acid Resistance Protein Active in Ribosomal Translocation and Recycling
17	PDB:4x3nA	0.099	0.191	7.122E-1	259	0.023	0.050	4x3nA.pdb.gz	Structure of the 34 kDa F-actin-bundling protein ABP34 from Dictyostelium discoideum.
18	PDB:2rvqC	0.065	0.187	9.573E-1	133	0.045	0.195	2rvqC.pdb.gz
19	PDB:7ajlAAA	0.093	0.167	9.573E-1	290	0.017	0.034	7ajlAAA.pdb.gz
20	PDB:7khsA	0.060	0.074	9.573E-1	449	0.014	0.018	7khsA.pdb.gz	Diazaspirononane Nonsaccharide Inhibitors of O-GlcNAcase (OGA) for the Treatment of Neurodegenerative Disorders.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95817	0.0	1150	575	1.000	1.000	BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3
2	Q9JLV1	0.0	836	577	0.842	0.839	BAG3_MOUSE BAG family molecular chaperone regulator 3 OS=Mus musculus OX=10090 GN=Bag3 PE=1 SV=2
3	Q6DC38	6.40e-64	218	459	0.318	0.399	Q6DC38_DANRE BAG family molecular chaperone regulator 3 OS=Danio rerio OX=7955 GN=zgc:100859 PE=2 SV=1
4	O95429	4.07e-22	101	457	0.082	0.103	BAG4_HUMAN BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4 PE=1 SV=1
5	Q8CI61	4.50e-22	101	457	0.082	0.103	BAG4_MOUSE BAG family molecular chaperone regulator 4 OS=Mus musculus OX=10090 GN=Bag4 PE=1 SV=2
6	Q5XIR5	4.89e-22	101	457	0.082	0.103	Q5XIR5_RAT BAG cochaperone 4 OS=Rattus norvegicus OX=10116 GN=Bag4 PE=1 SV=1
7	A0A8I6AP78	6.92e-22	100	457	0.082	0.103	A0A8I6AP78_RAT BAG cochaperone 4 OS=Rattus norvegicus OX=10116 GN=Bag4 PE=1 SV=1
8	Q9BLJ6	3.19e-13	75.1	677	0.071	0.061	BAGS_BOMMO BAG domain-containing protein Samui OS=Bombyx mori OX=7091 GN=Samui PE=2 SV=1
9	Q9UL15	5.03e-12	70.5	447	0.068	0.087	BAG5_HUMAN BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1
10	Q5QJC9	1.13e-10	66.2	447	0.056	0.072	BAG5_RAT BAG family molecular chaperone regulator 5 OS=Rattus norvegicus OX=10116 GN=Bag5 PE=1 SV=1
11	M9PCD9	1.29e-10	66.6	610	0.057	0.054	M9PCD9_DROME Starvin, isoform F OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
12	Q9VU81	1.36e-10	66.2	609	0.057	0.054	Q9VU81_DROME GH02003p OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=2
13	A8JNS4	1.38e-10	66.6	635	0.057	0.052	A8JNS4_DROME Starvin, isoform E OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
14	Q9VU83	2.42e-10	65.5	516	0.057	0.064	Q9VU83_DROME Starvin, isoform B OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
15	Q9VU82	2.56e-10	65.5	542	0.057	0.061	Q9VU82_DROME Starvin, isoform C OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
16	Q8CI32	1.33e-09	62.8	447	0.061	0.078	BAG5_MOUSE BAG family molecular chaperone regulator 5 OS=Mus musculus OX=10090 GN=Bag5 PE=1 SV=1
17	O14326	2.11e-07	56.2	786	0.059	0.043	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
18	A0A8I6GKS9	3.36e-07	55.8	942	0.038	0.023	A0A8I6GKS9_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
19	A0A0G2JUY1	3.54e-07	55.8	921	0.038	0.024	A0A0G2JUY1_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=2
20	A0A8I6A6J7	3.64e-07	55.8	921	0.038	0.024	A0A8I6A6J7_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02179 BAG	8.6e-15	66.4	BAG domain
2	PF00397 WW	4e-06	38.1	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358081

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281938	0.999	Heat shock protein beta-8
2	9606.ENSP00000302961	0.999	Heat shock protein family A member 4
3	9606.ENSP00000432083	0.999	Heat shock cognate 71 kDa protein
4	9606.ENSP00000364802	0.998	Heat shock 70 kDa protein 1A
5	9606.ENSP00000468057	0.993	Heat shock protein beta-6
6	9606.ENSP00000219548	0.988	E3 ubiquitin-protein ligase CHIP
7	9606.ENSP00000364801	0.985	Heat shock protein family A member 1B
8	9606.ENSP00000374455	0.980	Sequestosome-1
9	9606.ENSP00000364805	0.974	Heat shock 70 kDa protein 1-like
10	9606.ENSP00000378199	0.974	Heat shock-related 70 kDa protein 2
11	9606.ENSP00000306015	0.971	Synaptopodin-2
12	9606.ENSP00000324173	0.971	78 kDa glucose-regulated protein
13	9606.ENSP00000310219	0.968	Heat shock 70 kDa protein 6
14	9606.ENSP00000297185	0.955	Stress-70 protein, mitochondrial
15	9606.ENSP00000285667	0.949	Heat shock 70 kDa protein 13
16	9606.ENSP00000367623	0.949	Heat shock 70 kDa protein 14
17	9606.ENSP00000296464	0.945	Heat shock 70 kDa protein 4L
18	9606.ENSP00000358211	0.941	Heat shock protein family A member 12A
19	9606.ENSP00000420514	0.940	BAG family molecular chaperone regulator 1
20	9606.ENSP00000254963	0.939	Heat shock protein family A member 12B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.999	protein-containing complex binding
GO:0097159	0.977	organic cyclic compound binding
GO:1901363	0.976	heterocyclic compound binding
GO:0000166	0.826	nucleotide binding
GO:0098772	0.823	molecular function regulator activity
GO:0030554	0.813	adenyl nucleotide binding
GO:0140597	0.777	protein carrier chaperone
GO:0060590	0.769	ATPase regulator activity
GO:0050839	0.757	cell adhesion molecule binding
GO:0051087	0.752	chaperone binding
GO:0045296	0.740	cadherin binding
GO:0019899	0.625	enzyme binding
GO:0000774	0.541	adenyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0043066	0.980	negative regulation of apoptotic process
GO:0050896	0.945	response to stimulus
GO:0008152	0.942	metabolic process
GO:0032879	0.885	regulation of localization
GO:0071840	0.877	cellular component organization or biogenesis
GO:0048518	0.877	positive regulation of biological process
GO:0051716	0.874	cellular response to stimulus
GO:0016043	0.867	cellular component organization
GO:0007154	0.830	cell communication
GO:0023052	0.825	signaling
GO:0065008	0.811	regulation of biological quality
GO:0007165	0.796	signal transduction
GO:0044237	0.795	cellular metabolic process
GO:0019222	0.789	regulation of metabolic process
GO:0033157	0.754	regulation of intracellular protein transport
GO:0060255	0.749	regulation of macromolecule metabolic process
GO:0031323	0.732	regulation of cellular metabolic process
GO:0080090	0.719	regulation of primary metabolic process
GO:0031647	0.716	regulation of protein stability
GO:0051171	0.715	regulation of nitrogen compound metabolic process
GO:0051051	0.711	negative regulation of transport
GO:0006950	0.699	response to stress
GO:0048522	0.690	positive regulation of cellular process
GO:0097190	0.690	apoptotic signaling pathway
GO:0071704	0.670	organic substance metabolic process
GO:1903828	0.665	negative regulation of protein localization
GO:0009893	0.649	positive regulation of metabolic process
GO:0033554	0.631	cellular response to stress
GO:0051179	0.622	localization
GO:0044238	0.593	primary metabolic process
GO:0009892	0.590	negative regulation of metabolic process
GO:0007166	0.576	cell surface receptor signaling pathway
GO:0006807	0.546	nitrogen compound metabolic process
GO:0010660	0.540	regulation of muscle cell apoptotic process
GO:0043170	0.477	macromolecule metabolic process
GO:0019219	0.477	regulation of nucleobase-containing compound metabolic process
GO:0097191	0.477	extrinsic apoptotic signaling pathway
GO:0009628	0.471	response to abiotic stimulus
GO:0042592	0.457	homeostatic process
GO:0042221	0.456	response to chemical
GO:1901564	0.452	organonitrogen compound metabolic process
GO:0031325	0.449	positive regulation of cellular metabolic process
GO:0032387	0.449	negative regulation of intracellular transport
GO:0009605	0.428	response to external stimulus
GO:0006996	0.408	organelle organization
GO:0051234	0.400	establishment of localization
GO:0006810	0.379	transport
GO:0051172	0.365	negative regulation of nitrogen compound metabolic process
GO:0010604	0.360	positive regulation of macromolecule metabolic process
GO:0010605	0.350	negative regulation of macromolecule metabolic process
GO:0022607	0.338	cellular component assembly
GO:0031324	0.338	negative regulation of cellular metabolic process
GO:0010556	0.331	regulation of macromolecule biosynthetic process
GO:0031326	0.331	regulation of cellular biosynthetic process
GO:0010033	0.329	response to organic substance
GO:0010468	0.329	regulation of gene expression
GO:0050821	0.325	protein stabilization
GO:0051252	0.325	regulation of RNA metabolic process
GO:0019538	0.320	protein metabolic process
GO:0009056	0.308	catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0032991	0.993	protein-containing complex
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005829	0.990	cytosol
GO:0005634	0.976	nucleus
GO:0070013	0.936	intracellular organelle lumen
GO:0140535	0.919	intracellular protein-containing complex
GO:0005856	0.792	cytoskeleton
GO:0101031	0.625	chaperone complex
GO:0099081	0.525	supramolecular polymer
GO:0099512	0.524	supramolecular fiber
GO:0030016	0.472	myofibril
GO:0030017	0.457	sarcomere
GO:0031981	0.454	nuclear lumen
GO:0031674	0.442	I band
GO:0012505	0.413	endomembrane system
GO:0016234	0.413	inclusion body
GO:0030018	0.408	Z disc
GO:0016020	0.315	membrane
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]