StarFunc result for job id O95819

User Input

>input (1239 residues)
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
VLQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQHSQQPP
PPQQERSKPSFHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRS
ESFSNGNSESVHPALQRPAEPQVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSIE
PRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSGERFRVRSSSKSEGSPSQRL
ENAVKKPEDKKEVFRPLKPADLTALAKELRAVEDVRPPHKVTDYSSSSEESGTTDEEDDD
VEQEGADESTSGPEDTRAASSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQT
QSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGS
VVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYP
LINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDL
EGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEE
GQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDE
GVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRA
QRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K490	0.380	0.354	0.000	1360	0.704	0.641	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
2	AFDB:A0A0G2K7W4	0.397	0.371	0.000	1348	0.959	0.881	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
3	AFDB:A0A0R4IEP9	0.388	0.367	0.000	1332	0.684	0.637	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
4	AFDB:F1LP90	0.294	0.275	0.000	1336	0.663	0.615	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
5	AFDB:M9PBJ7	0.402	0.409	0.000	1213	0.507	0.518	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
6	AFDB:O95819	1.000	1.000	0.000	1239	1.000	1.000	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2
7	AFDB:P83510	0.468	0.444	0.000	1323	0.691	0.647	P83510.pdb.gz	TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus OX=10090 GN=Tnik PE=1 SV=2
8	AFDB:Q9JM52	0.276	0.262	0.000	1308	0.647	0.613	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
9	AFDB:Q9W002	0.260	0.216	2.568E-101	1504	0.525	0.433	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
10	AFDB:P38692	0.219	0.250	8.805E-24	1080	0.165	0.190	P38692.pdb.gz	KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIC1 PE=1 SV=1
11	PDB:3eqdA	0.206	0.766	1.042E-20	315	0.072	0.283	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
12	PDB:4krcA	0.185	0.717	1.495E-17	297	0.069	0.286	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
13	PDB:4yc3A	0.184	0.728	3.684E-17	295	0.062	0.261	4yc3A.pdb.gz
14	PDB:5eymA	0.180	0.714	3.884E-17	292	0.064	0.271	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
15	PDB:4eomC	0.188	0.792	5.631E-17	276	0.059	0.264	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:1blxA	0.188	0.680	5.938E-17	305	0.062	0.252	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
17	PDB:5u6yA	0.190	0.489	7.742E-17	459	0.060	0.161	5u6yA.pdb.gz
18	PDB:8a8mB	0.196	0.753	1.009E-16	298	0.074	0.309	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
19	PDB:1unlA	0.184	0.721	1.064E-16	292	0.061	0.257	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:4c0tA	0.191	0.760	1.716E-16	291	0.052	0.223	4c0tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A097PIG6	613	694	0.234	0.418	A0A097PIG6_RAT Mitogen-activated protein kinase kinase kinase kinase 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=2 SV=1
2	A0A0G2K490	1493	1360	0.720	0.656	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
3	A0A0G2K7W4	848	1379	0.323	0.290	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
4	A0A0R4IEP9	1386	1332	0.670	0.623	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
5	A0A8I5ZL09	778	1321	0.428	0.401	A0A8I5ZL09_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
6	A0A8I5ZLV4	847	1382	0.323	0.289	A0A8I5ZLV4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
7	A0A8I5ZQ07	1449	1340	0.700	0.647	A0A8I5ZQ07_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
8	A0A8I5ZV95	1477	1305	0.710	0.674	A0A8I5ZV95_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
9	A0A8I5ZYP2	847	1325	0.323	0.302	A0A8I5ZYP2_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
10	A0A8I6ADP3	1169	1287	0.513	0.493	A0A8I6ADP3_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
11	A0A8I6AHN7	847	1302	0.323	0.307	A0A8I6AHN7_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
12	A0A8I6AT99	1122	1248	0.621	0.616	A0A8I6AT99_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=1
13	A0A8I6GFX7	1420	1318	0.689	0.648	A0A8I6GFX7_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
14	A0A8I6GLD8	1501	1352	0.720	0.660	A0A8I6GLD8_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1
15	D3ZZQ0	1309	1260	0.647	0.637	D3ZZQ0_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=2
16	F1LP90	1338	1336	0.665	0.617	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
17	F1M754	1712	1146	0.842	0.910	F1M754_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=3
18	M9PBJ7	590	1213	0.227	0.232	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
19	M9PH19	592	1404	0.227	0.200	M9PH19_DROME Misshapen, isoform F OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
20	O95819	2555	1239	1.000	1.000	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.068	23.8	ABC1 atypical kinase-like domain
2	PF00780 CNH	6.6e-59	211.4	CNH domain
3	PF17400 DUF5406	1.4e+02	14.2	Family of unknown function (DUF5406)
4	PF00069 Pkinase	1.8e-58	209.6	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	1.2e-41	154.3	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000021059

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000026594	0.928	Pan troglodytes NCK adaptor protein 1 (NCK1), mRNA
2	9598.ENSPTRP00000048240	0.746	Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
3	9598.ENSPTRP00000057993	0.741	Mitogen-activated protein kinase kinase kinase 7
4	9598.ENSPTRP00000044466	0.738	Catenin (Cadherin-associated protein), beta 1, 88kDa
5	9598.ENSPTRP00000036949	0.734	Belongs to the TNF receptor-associated factor family.
6	9598.ENSPTRP00000006096	0.732	Belongs to the TNF receptor-associated factor family.
7	9598.ENSPTRP00000021097	0.728	NCK adaptor protein 2
8	9598.ENSPTRP00000031895	0.708	TGF-beta activated kinase 1/MAP3K7 binding protein 2
9	9598.ENSPTRP00000011503	0.699	Belongs to the TNF receptor-associated factor family.
10	9598.ENSPTRP00000043317	0.692	Mitogen-activated protein kinase kinase kinase 5
11	9598.ENSPTRP00000054518	0.687	Tumor necrosis factor
12	9598.ENSPTRP00000055512	0.686	Conserved helix-loop-helix ubiquitous kinase
13	9598.ENSPTRP00000030180	0.683	Receptor (TNFRSF)-interacting serine-threonine kinase 1
14	9598.ENSPTRP00000037780	0.681	ephrin-B1
15	9598.ENSPTRP00000010174	0.680	RAP2A, member of RAS oncogene family
16	9598.ENSPTRP00000033919	0.674	Caspase 2, apoptosis-related cysteine peptidase
17	9598.ENSPTRP00000016161	0.672	Mitogen-activated protein kinase kinase kinase 3
18	9598.ENSPTRP00000021280	0.672	Mitogen-activated protein kinase kinase kinase 2
19	9598.ENSPTRP00000034600	0.671	Inhibitor of nuclear factor kappa B kinase subunit beta
20	9598.ENSPTRP00000030111	0.666	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	1.000	ATP binding
GO:0008092	0.857	cytoskeletal protein binding
GO:0015631	0.816	tubulin binding
GO:0008017	0.813	microtubule binding
GO:0016775	0.808	phosphotransferase activity, nitrogenous group as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.980	regulation of cellular process
GO:0048583	0.945	regulation of response to stimulus
GO:0080135	0.944	regulation of cellular response to stress
GO:0023051	0.899	regulation of signaling
GO:0010646	0.895	regulation of cell communication
GO:0009987	0.846	cellular process
GO:0048519	0.801	negative regulation of biological process
GO:0050896	0.697	response to stimulus
GO:0048523	0.690	negative regulation of cellular process
GO:0031345	0.635	negative regulation of cell projection organization
GO:0070571	0.617	negative regulation of neuron projection regeneration
GO:0061178	0.605	regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0046676	0.598	negative regulation of insulin secretion
GO:0048518	0.492	positive regulation of biological process
GO:0048522	0.442	positive regulation of cellular process
GO:0008152	0.367	metabolic process
GO:0071704	0.360	organic substance metabolic process
GO:0044238	0.359	primary metabolic process
GO:0006807	0.331	nitrogen compound metabolic process
GO:0042221	0.319	response to chemical
GO:0032501	0.306	multicellular organismal process
GO:0043170	0.300	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0030054	0.990	cell junction
GO:0005737	0.972	cytoplasm
GO:0043232	0.844	intracellular non-membrane-bounded organelle
GO:0030055	0.731	cell-substrate junction
GO:0045202	0.512	synapse
GO:0043227	0.341	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.3.-	0.808	Phosphotransferases with a nitrogenous group as acceptor.

[back to server]