StarFunc result for job id O95822

User Input

>input (493 residues)
MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKT
PAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAA
VLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNG
VLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFF
SHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQG
VELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSEC
KEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVA
NFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQV
LSLVAQFQKNSKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95822	1.000	1.000	5.424E-82	493	1.000	1.000	O95822.pdb.gz	DCMC_HUMAN Malonyl-CoA decarboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=MLYCD PE=1 SV=3
2	AFDB:Q920F5	0.929	0.931	1.471E-74	492	0.888	0.890	Q920F5.pdb.gz	DCMC_RAT Malonyl-CoA decarboxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mlycd PE=1 SV=1
3	PDB:4f0xA	0.903	0.975	1.737E-68	456	0.923	0.998	4f0xA.pdb.gz	Structural Asymmetry and Disulfide Bridges among Subunits Modulate the Activity of Human Malonyl-CoA Decarboxylase.
4	PDB:2ygwA	0.824	0.974	4.029E-62	416	0.815	0.966	2ygwA.pdb.gz
5	AFDB:Q7Y1Z8	0.823	0.785	1.486E-40	518	0.377	0.359	Q7Y1Z8.pdb.gz	Q7Y1Z8_ARATH Malonyl-CoA decarboxylase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g04320 PE=1 SV=1
6	AFDB:Q6NCB2	0.720	0.745	1.428E-31	476	0.284	0.294	Q6NCB2.pdb.gz	Q6NCB2_RHOPA Malonyl-CoA decarboxylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) OX=258594 GN=MLYCD/MCD PE=1 SV=1
7	AFDB:B9K0V9	0.757	0.800	1.572E-31	465	0.262	0.277	B9K0V9.pdb.gz	B9K0V9_ALLAM Malonyl-CoA decarboxylase OS=Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4) OX=311402 GN=Avi_5372 PE=1 SV=1
8	PDB:4ksaA	0.698	0.781	8.701E-29	437	0.288	0.325	4ksaA.pdb.gz
9	PDB:4ksfA	0.724	0.866	5.986E-28	407	0.260	0.314	4ksfA.pdb.gz
10	AFDB:Q57VP8	0.616	0.424	5.363E-25	741	0.278	0.185	Q57VP8.pdb.gz	Q57VP8_TRYB2 Malonyl-CoA decarboxylase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.110 PE=4 SV=1
11	PDB:2zpaB	0.206	0.157	4.279E-3	662	0.093	0.069	2zpaB.pdb.gz	RNA helicase module in an acetyltransferase that modifies a specific tRNA anticodon
12	PDB:1tiqA	0.171	0.446	8.819E-3	173	0.034	0.098	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
13	PDB:4evyA	0.205	0.586	1.499E-2	147	0.030	0.102	4evyA.pdb.gz	Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
14	PDB:4crzB	0.183	0.605	2.204E-2	128	0.037	0.141	4crzB.pdb.gz	The Structure of the Pand/Panz Protein Complex Reveals Negative Feedback Regulation of Pantothenate Biosynthesis by Coenzyme A.
15	PDB:2wpwA	0.195	0.281	2.547E-2	328	0.043	0.064	2wpwA.pdb.gz	Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
16	PDB:6ygbA	0.186	0.511	3.089E-2	159	0.028	0.088	6ygbA.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
17	AFDB:O76858	0.168	0.106	3.401E-2	879	0.043	0.024	O76858.pdb.gz	O76858_DROME Ebony protein OS=Drosophila melanogaster OX=7227 GN=e PE=4 SV=1
18	AFDB:A0A178W1H3	0.176	0.406	3.930E-2	183	0.034	0.093	A0A178W1H3.pdb.gz	A0A178W1H3_ARATH N-acetyltransferase domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g32020 PE=1 SV=1
19	AFDB:A0A178VTR0	0.171	0.382	4.542E-2	188	0.047	0.122	A0A178VTR0.pdb.gz	A0A178VTR0_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At2g32030 PE=1 SV=1
20	AFDB:Q95SX8	0.199	0.334	5.508E-2	276	0.024	0.043	Q95SX8.pdb.gz	NAA60_DROME N-alpha-acetyltransferase 60 OS=Drosophila melanogaster OX=7227 GN=Naa60 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95822	0.0	1011	493	1.000	1.000	DCMC_HUMAN Malonyl-CoA decarboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=MLYCD PE=1 SV=3
2	Q920F5	0.0	861	492	0.838	0.839	DCMC_RAT Malonyl-CoA decarboxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mlycd PE=1 SV=1
3	Q99J39	0.0	854	492	0.834	0.835	DCMC_MOUSE Malonyl-CoA decarboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Mlycd PE=1 SV=1
4	Q7Y1Z8	4.01e-93	294	518	0.367	0.349	Q7Y1Z8_ARATH Malonyl-CoA decarboxylase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g04320 PE=1 SV=1
5	Q6NCB2	9.55e-61	208	476	0.274	0.284	Q6NCB2_RHOPA Malonyl-CoA decarboxylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) OX=258594 GN=MLYCD/MCD PE=1 SV=1
6	B9K0V9	1.13e-56	197	465	0.282	0.299	B9K0V9_ALLAM Malonyl-CoA decarboxylase OS=Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4) OX=311402 GN=Avi_5372 PE=1 SV=1
7	Q57VP8	6.59e-23	104	741	0.134	0.089	Q57VP8_TRYB2 Malonyl-CoA decarboxylase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.110 PE=4 SV=1
8	P50275	0.49	35.4	885	0.057	0.032	ASE1_YEAST Anaphase spindle elongation protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASE1 PE=1 SV=1
9	Q8C3X4	1.6	33.9	651	0.045	0.034	GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus OX=10090 GN=Guf1 PE=1 SV=1
10	P76347	4.3	32.7	2358	0.055	0.011	YEEJ_ECOLI Uncharacterized protein YeeJ OS=Escherichia coli (strain K12) OX=83333 GN=yeeJ PE=3 SV=3
11	Q389N4	9.1	31.2	312	0.045	0.071	Q389N4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.1000 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05292 MCD	6e-90	312.9	Malonyl-CoA decarboxylase C-terminal domain
2	PF17408 MCD_N	1.7e-09	49.0	Malonyl-CoA decarboxylase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262430

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221418	0.963	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
2	9606.ENSP00000217455	0.960	Acyl-coenzyme A thioesterase 8
3	9606.ENSP00000265322	0.954	Peroxisomal trans-2-enoyl-CoA reductase
4	9606.ENSP00000317721	0.951	Peroxisomal sarcosine oxidase
5	9606.ENSP00000369461	0.951	Enoyl-CoA delta isomerase 2, mitochondrial
6	9606.ENSP00000231887	0.950	Peroxisomal bifunctional enzyme
7	9606.ENSP00000285737	0.949	Lon protease homolog 2, peroxisomal
8	9606.ENSP00000293217	0.949	Peroxisomal acyl-coenzyme A oxidase 1
9	9606.ENSP00000483507	0.949	Hydroxyacid oxidase 2
10	9606.ENSP00000355607	0.948	Glyceronephosphate O-acyltransferase
11	9606.ENSP00000371517	0.948	Alpha-methylacyl-CoA racemase
12	9606.ENSP00000259407	0.946	Bile acid-CoA:amino acid N-acyltransferase
13	9606.ENSP00000348775	0.946	Peroxisomal acyl-coenzyme A oxidase 3
14	9606.ENSP00000307697	0.944	Peroxisomal acyl-coenzyme A oxidase 2
15	9606.ENSP00000368066	0.944	Hydroxyacid oxidase 1
16	9606.ENSP00000302620	0.942	Alanine-glyoxylate aminotransferase
17	9606.ENSP00000315013	0.939	Carnitine O-acetyltransferase
18	9606.ENSP00000413575	0.939	Peroxisomal carnitine O-octanoyltransferase
19	9606.ENSP00000238651	0.938	Acyl-coenzyme A thioesterase 2, mitochondrial
20	9606.ENSP00000420914	0.935	Peroxisomal multifunctional enzyme type 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050080	1.000	malonyl-CoA decarboxylase activity
GO:0042802	0.997	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0044238	0.987	primary metabolic process
GO:0044281	0.979	small molecule metabolic process
GO:0006629	0.973	lipid metabolic process
GO:0044249	0.970	cellular biosynthetic process
GO:1901576	0.966	organic substance biosynthetic process
GO:0006082	0.962	organic acid metabolic process
GO:0006631	0.950	fatty acid metabolic process
GO:0050794	0.938	regulation of cellular process
GO:0009056	0.934	catabolic process
GO:1901575	0.922	organic substance catabolic process
GO:0044248	0.919	cellular catabolic process
GO:0006807	0.901	nitrogen compound metabolic process
GO:0090407	0.896	organophosphate biosynthetic process
GO:1901564	0.885	organonitrogen compound metabolic process
GO:1901360	0.881	organic cyclic compound metabolic process
GO:0034641	0.880	cellular nitrogen compound metabolic process
GO:0006796	0.880	phosphate-containing compound metabolic process
GO:0019222	0.863	regulation of metabolic process
GO:0009260	0.846	ribonucleotide biosynthetic process
GO:0035384	0.843	thioester biosynthetic process
GO:0033866	0.843	nucleoside bisphosphate biosynthetic process
GO:0009152	0.838	purine ribonucleotide biosynthetic process
GO:0071616	0.834	acyl-CoA biosynthetic process
GO:0048518	0.825	positive regulation of biological process
GO:0008610	0.801	lipid biosynthetic process
GO:0006084	0.787	acetyl-CoA metabolic process
GO:1901565	0.782	organonitrogen compound catabolic process
GO:0031323	0.779	regulation of cellular metabolic process
GO:0080090	0.772	regulation of primary metabolic process
GO:0009893	0.766	positive regulation of metabolic process
GO:0048522	0.759	positive regulation of cellular process
GO:0006109	0.740	regulation of carbohydrate metabolic process
GO:0031325	0.738	positive regulation of cellular metabolic process
GO:0019216	0.718	regulation of lipid metabolic process
GO:0062012	0.712	regulation of small molecule metabolic process
GO:0045834	0.679	positive regulation of lipid metabolic process
GO:0062013	0.677	positive regulation of small molecule metabolic process
GO:0006085	0.677	acetyl-CoA biosynthetic process
GO:0044273	0.670	sulfur compound catabolic process
GO:0009166	0.659	nucleotide catabolic process
GO:0010675	0.646	regulation of cellular carbohydrate metabolic process
GO:0019217	0.646	regulation of fatty acid metabolic process
GO:0006195	0.643	purine nucleotide catabolic process
GO:0045923	0.633	positive regulation of fatty acid metabolic process
GO:0046320	0.625	regulation of fatty acid oxidation
GO:0009154	0.624	purine ribonucleotide catabolic process
GO:0010906	0.470	regulation of glucose metabolic process
GO:0044283	0.448	small molecule biosynthetic process
GO:0072330	0.403	monocarboxylic acid biosynthetic process
GO:0034440	0.304	lipid oxidation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005739	1.000	mitochondrion
GO:0005782	0.996	peroxisomal matrix
GO:0005759	0.492	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18781	1.000	H(+) + malonyl-CoA = acetyl-CoA + CO2
EC:4.1.1.9	1.000	malonyl-CoA decarboxylase.

[back to server]