StarFunc result for job id O95825

User Input

>input (349 residues)
MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLF
PVGREIAGIVLDVGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWT
EAAGSIRDGVRAYTALHYLSHLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLE
DKQCLERFRPPIARVIDVSNGKVHVAESCLEETGGLGVDIVLDAGVRLYSKDDEPAVKLQ
LLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGATLAFLNDEVWNLSNVQQGKY
LCILKDVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVVQF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95825	1.000	1.000	6.157E-79	349	1.000	1.000	O95825.pdb.gz	QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens OX=9606 GN=CRYZL1 PE=1 SV=2
2	PDB:7nd2C	0.970	0.962	4.643E-63	352	0.997	0.989	7nd2C.pdb.gz
3	AFDB:A0A098D8A0	0.722	0.121	1.512E-26	2352	0.255	0.038	A0A098D8A0.pdb.gz	ZEA2_GIBZE Highly reducing polyketide synthase ZEA2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEA2 PE=2 SV=1
4	AFDB:Q9LXZ4	0.782	0.784	2.464E-26	348	0.192	0.193	Q9LXZ4.pdb.gz	Q9LXZ4_ARATH GroES-like zinc-binding alcohol dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=T5P19_110 PE=1 SV=1
5	AFDB:O53901	0.743	0.138	2.829E-25	2108	0.212	0.035	O53901.pdb.gz	PKS5_MYCTU Mycocerosic acid synthase-like polyketide synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pks5 PE=1 SV=2
6	AFDB:P9WQE9	0.751	0.138	4.079E-25	2126	0.206	0.034	P9WQE9.pdb.gz	PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pks2 PE=1 SV=1
7	AFDB:A0A089QRB9	0.750	0.140	9.584E-25	2085	0.223	0.037	A0A089QRB9.pdb.gz	MSL3_MYCTU Mycolipanoate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=msl3 PE=1 SV=2
8	AFDB:P96202	0.752	0.133	9.584E-25	2188	0.201	0.032	P96202.pdb.gz	PPSC_MYCTU Phenolphthiocerol/phthiocerol polyketide synthase subunit C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppsC PE=1 SV=2
9	AFDB:Q3UNZ8	0.754	0.752	2.119E-24	350	0.206	0.206	Q3UNZ8.pdb.gz	QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus OX=10090 GN=Cryzl2 PE=1 SV=1
10	AFDB:Q9I0Z1	0.793	0.815	3.900E-24	339	0.198	0.204	Q9I0Z1.pdb.gz	Q9I0Z1_PSEAE Probable oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA2491 PE=4 SV=1
11	AFDB:P28304	0.790	0.839	4.145E-24	327	0.198	0.211	P28304.pdb.gz	QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) OX=83333 GN=qorA PE=1 SV=1
12	PDB:2obyA	0.751	0.782	1.045E-23	334	0.244	0.254	2obyA.pdb.gz	Crystal structure of human P53 inducible oxidoreductase (TP53I3, PIG3)
13	PDB:1qorA	0.748	0.795	3.134E-23	326	0.198	0.212	1qorA.pdb.gz	Crystal structure of Escherichia coli QOR quinone oxidoreductase complexed with NADPH.
14	PDB:1yb5A	0.740	0.791	9.399E-23	324	0.181	0.194	1yb5A.pdb.gz	Crystal Structure of human Zeta-Crystallin at 1.85A
15	PDB:3qwaB	0.763	0.799	3.385E-22	332	0.163	0.172	3qwaB.pdb.gz
16	PDB:1wlyA	0.766	0.825	7.483E-22	322	0.203	0.220	1wlyA.pdb.gz
17	PDB:8b27B	0.724	0.779	1.464E-21	322	0.172	0.186	8b27B.pdb.gz
18	PDB:6k9yA	0.748	0.761	2.385E-21	342	0.206	0.211	6k9yA.pdb.gz
19	PDB:5a3jC	0.740	0.786	1.400E-20	327	0.198	0.211	5a3jC.pdb.gz	Crystal Structure of the Chloroplastic Oxoene Reductase ceQORH from Arabidopsis thaliana.
20	PDB:4rvuA	0.765	0.808	1.582E-20	329	0.175	0.185	4rvuA.pdb.gz	Structural views of quinone oxidoreductase from Mycobacterium tuberculosis reveal large conformational changes induced by the co-factor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95825	0.0	717	349	1.000	1.000	QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens OX=9606 GN=CRYZL1 PE=1 SV=2
2	Q924D0	3.66e-13	72.0	396	0.172	0.152	RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Rtn4ip1 PE=1 SV=2
3	O97764	5.88e-13	71.2	330	0.201	0.212	QOR_BOVIN Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2
4	Q6DNE5	2.14e-12	70.9	2199	0.178	0.028	Q6DNE5_9CYAN CurH OS=Lyngbya majuscula OX=158786 GN=curH PE=1 SV=1
5	B2R9Y1	1.61e-11	67.0	354	0.140	0.138	B2R9Y1_HUMAN cDNA, FLJ94608, Homo sapiens reticulon 4 interacting protein 1 (RTN4IP1), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
6	Q08257	1.65e-11	66.6	329	0.221	0.234	QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1
7	Q8WWV3	2.85e-11	66.2	396	0.140	0.124	RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=RTN4IP1 PE=1 SV=2
8	Q7T3C7	5.05e-11	65.5	387	0.195	0.176	RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio OX=7955 GN=rtn4ip1 PE=2 SV=2
9	A0A098D8A0	6.09e-11	66.2	2352	0.269	0.040	ZEA2_GIBZE Highly reducing polyketide synthase ZEA2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEA2 PE=2 SV=1
10	P11415	1.72e-10	63.5	329	0.132	0.140	QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus OX=10141 GN=CRYZ PE=1 SV=1
11	Q6DNE2	2.10e-10	64.7	2232	0.158	0.025	Q6DNE2_9CYAN CurK OS=Lyngbya majuscula OX=158786 GN=curK PE=1 SV=1
12	Q53FA7	6.30e-10	62.0	332	0.172	0.181	QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens OX=9606 GN=TP53I3 PE=1 SV=2
13	B2HIL7	1.92e-09	61.6	2104	0.146	0.024	MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) OX=216594 GN=pks15/1 PE=1 SV=1
14	O65423	2.27e-09	60.1	325	0.163	0.175	O65423_ARATH AT4g21580/F18E5_200 OS=Arabidopsis thaliana OX=3702 GN=F18E5.200 PE=1 SV=1
15	Q582N8	3.75e-09	59.7	339	0.120	0.124	Q582N8_TRYB2 Oxidoreductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.760 PE=4 SV=1
16	Q9ZUC1	4.39e-09	59.7	386	0.175	0.158	AOR_ARATH NADPH-dependent alkenal/one oxidoreductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AOR PE=1 SV=2
17	A5YV76	1.50e-08	58.9	2512	0.120	0.017	A5YV76_PIG Fatty acid synthase OS=Sus scrofa OX=9823 GN=FASN PE=1 SV=1
18	Q9I0Z1	1.84e-08	57.4	339	0.169	0.174	Q9I0Z1_PSEAE Probable oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA2491 PE=4 SV=1
19	P95185	3.24e-08	56.6	323	0.186	0.201	P95185_MYCTU Probable NADPH quinone oxidoreductase FadB4 (NADPH:quinone reductase) (Zeta-crystallin) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadB4 PE=1 SV=1
20	Q6AYT0	5.69e-08	55.8	329	0.209	0.222	QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus OX=10116 GN=Cryz PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08240 ADH_N	1.6	20.0	Alcohol dehydrogenase GroES-like domain
2	PF00107 ADH_zinc_N	0.071	24.6	Zinc-binding dehydrogenase
3	PF13602 ADH_zinc_N_2	74	15.8	Zinc-binding dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370966

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245185	0.775	Metallothionein-2
2	9606.ENSP00000219599	0.746	Ketimine reductase mu-crystallin
3	9606.ENSP00000307143	0.745	Protein downstream neighbor of Son
4	9606.ENSP00000226299	0.742	Cytosol aminopeptidase
5	9606.ENSP00000261024	0.732	Solute carrier family 40 member 1
6	9606.ENSP00000298248	0.723	Lambda-crystallin homolog
7	9606.ENSP00000382250	0.719	Mitochondrial ribosomal protein S6
8	9606.ENSP00000348984	0.715	Protein SON
9	9606.ENSP00000263702	0.695	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
10	9606.ENSP00000207870	0.660	Xylulose kinase
11	9606.ENSP00000439768	0.659	Belongs to the UPF0220 family
12	9606.ENSP00000305664	0.610	TraB domain-containing protein
13	9606.ENSP00000435777	0.607	Ribosomal protein S13
14	9606.ENSP00000323678	0.605	Prostaglandin reductase 3
15	9606.ENSP00000294952	0.569	Protein phosphatase 1 regulatory subunit 21
16	9606.ENSP00000420037	0.552	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
17	9606.ENSP00000329915	0.540	Proteasome assembly chaperone 1
18	9606.ENSP00000330753	0.510	Bromodomain and WD repeat-containing protein 1
19	9606.ENSP00000332404	0.505	Transmembrane and immunoglobulin domain-containing protein 1
20	9606.ENSP00000370543	0.505	Sodium/myo-inositol cotransporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	0.999	catalytic activity
GO:0005515	0.999	protein binding
GO:0016491	0.992	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0008152	0.784	metabolic process
GO:0065007	0.668	biological regulation
GO:0071704	0.552	organic substance metabolic process
GO:0050789	0.499	regulation of biological process
GO:0044237	0.401	cellular metabolic process
GO:0050794	0.350	regulation of cellular process
GO:0044238	0.349	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043229	0.856	intracellular organelle
GO:0043231	0.840	intracellular membrane-bounded organelle
GO:0016020	0.302	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.992	Oxidoreductases.

[back to server]