StarFunc result for job id O95831

User Input

>input (613 residues)
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEG
EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE
ITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A068CA64	0.811	0.811	0.000	613	0.945	0.945	A0A068CA64.pdb.gz	A0A068CA64_PIG Mitochondrial apoptosis-inducing factor 1 transcript variant 1 OS=Sus scrofa OX=9823 GN=AIFM1 PE=1 SV=1
2	AFDB:Q9VQ79	0.721	0.600	6.981E-74	739	0.449	0.372	Q9VQ79.pdb.gz	AIFM1_DROME Putative apoptosis-inducing factor 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=AIF PE=2 SV=2
3	AFDB:Q9U229	0.690	0.606	6.159E-57	700	0.310	0.271	Q9U229.pdb.gz	Q9U229_CAEEL Pyr_redox_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=wah-1 PE=1 SV=2
4	AFDB:Q9GRX6	0.667	0.766	4.562E-56	532	0.312	0.359	Q9GRX6.pdb.gz	AIFM1_DICDI Apoptosis-inducing factor 1, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=aif PE=2 SV=1
5	AFDB:P92947	0.591	0.727	2.441E-36	493	0.197	0.245	P92947.pdb.gz	MDAR_ARATH Monodehydroascorbate reductase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MDAR5 PE=1 SV=3
6	AFDB:X5CY81	0.596	0.874	9.636E-36	410	0.170	0.254	X5CY81.pdb.gz	CNDC1_RHIWD Chloroacetanilide N-alkylformylase, ferredoxin reductase component OS=Rhizorhabdus wittichii (strain DC-6 / KACC 16600) OX=1283312 GN=cndC1 PE=1 SV=1
7	AFDB:P95034	0.585	0.863	1.144E-35	406	0.188	0.283	P95034.pdb.gz	P95034_MYCTU Ferredoxin reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0688 PE=1 SV=1
8	AFDB:P77650	0.566	0.844	1.808E-35	400	0.162	0.247	P77650.pdb.gz	HCAD_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) OX=83333 GN=hcaD PE=1 SV=1
9	AFDB:Q93WJ8	0.571	0.788	8.003E-35	435	0.176	0.248	Q93WJ8.pdb.gz	MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana OX=3702 GN=MDAR2 PE=1 SV=1
10	AFDB:D5IGG6	0.601	0.873	8.973E-35	414	0.157	0.232	D5IGG6.pdb.gz	FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. OX=28214 GN=fdr PE=1 SV=1
11	PDB:5jciA	0.588	0.818	1.928E-34	432	0.178	0.252	5jciA.pdb.gz	Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
12	PDB:1q1wA	0.576	0.818	5.557E-32	422	0.160	0.232	1q1wA.pdb.gz	Crystal structure of putidaredoxin reductase from Pseudomonas putida, the final structural component of the cytochrome P450cam monooxygenase.
13	PDB:2v3aA	0.506	0.780	2.964E-28	381	0.131	0.210	2v3aA.pdb.gz	Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
14	PDB:3kljA	0.501	0.783	4.062E-26	378	0.142	0.230	3kljA.pdb.gz	Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
15	PDB:1gerB	0.478	0.636	2.884E-22	449	0.137	0.187	1gerB.pdb.gz	Structure of glutathione reductase from Escherichia coli at 1.86 A resolution: comparison with the enzyme from human erythrocytes.
16	PDB:1ebdA	0.481	0.630	1.276E-21	455	0.150	0.202	1ebdA.pdb.gz	Protein-protein interactions in the pyruvate dehydrogenase multienzyme complex: dihydrolipoamide dehydrogenase complexed with the binding domain of dihydrolipoamide acetyltransferase.
17	PDB:4jdrA	0.474	0.601	1.699E-21	471	0.137	0.178	4jdrA.pdb.gz	Insight to the Interaction of the Dihydrolipoamide Acetyltransferase (E2) Core with the Peripheral Components in the Escherichia coli Pyruvate Dehydrogenase Complex via Multifaceted Structural Approaches.
18	PDB:1xdiA	0.452	0.580	2.262E-21	459	0.147	0.196	1xdiA.pdb.gz	Characterization of a New Member of the Flavoprotein Disulfide Reductase Family of Enzymes from Mycobacterium tuberculosis
19	PDB:6zk7AAAA	0.493	0.684	3.575E-21	425	0.126	0.181	6zk7AAAA.pdb.gz	The oxidoreductase PYROXD1 uses NAD(P) + as an antioxidant to sustain tRNA ligase activity in pre-tRNA splicing and unfolded protein response.
20	PDB:7kmyA	0.467	0.600	5.982E-21	465	0.145	0.191	7kmyA.pdb.gz	Whole cell active inhibitors of mycobacterial lipoamide dehydrogenase afford selectivity over the human enzyme through tight binding interactions

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A068CA64	0.0	1176	613	0.945	0.945	A0A068CA64_PIG Mitochondrial apoptosis-inducing factor 1 transcript variant 1 OS=Sus scrofa OX=9823 GN=AIFM1 PE=1 SV=1
2	E9PMA0	0.0	566	274	0.447	1.000	E9PMA0_HUMAN Apoptosis inducing factor mitochondria associated 1 OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1
3	O95831	0.0	1258	613	1.000	1.000	AIFM1_HUMAN Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1
4	Q9JM53	0.0	1126	612	0.925	0.926	AIFM1_RAT Apoptosis-inducing factor 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aifm1 PE=1 SV=1
5	Q9Z0X1	0.0	1125	612	0.922	0.923	AIFM1_MOUSE Apoptosis-inducing factor 1, mitochondrial OS=Mus musculus OX=10090 GN=Aifm1 PE=1 SV=1
6	Q9VQ79	6.04e-171	506	739	0.413	0.342	AIFM1_DROME Putative apoptosis-inducing factor 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=AIF PE=2 SV=2
7	Q9GRX6	1.12e-108	338	532	0.323	0.372	AIFM1_DICDI Apoptosis-inducing factor 1, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=aif PE=2 SV=1
8	Q9U229	3.99e-97	313	700	0.300	0.263	Q9U229_CAEEL Pyr_redox_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=wah-1 PE=1 SV=2
9	P95034	3.67e-31	127	406	0.171	0.259	P95034_MYCTU Ferredoxin reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0688 PE=1 SV=1
10	Q96NN9	5.50e-25	112	605	0.184	0.187	AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens OX=9606 GN=AIFM3 PE=1 SV=1
11	P95146	7.56e-25	109	411	0.171	0.255	P95146_MYCTU Probable reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1869c PE=1 SV=1
12	C9K029	2.09e-24	110	596	0.186	0.191	C9K029_HUMAN Apoptosis inducing factor mitochondria associated 3 OS=Homo sapiens OX=9606 GN=AIFM3 PE=1 SV=3
13	F2Z4R3	4.40e-23	105	599	0.186	0.190	F2Z4R3_DANRE Apoptosis-inducing factor 3 OS=Danio rerio OX=7955 GN=aifm3 PE=4 SV=1
14	Q9LK94	4.57e-23	105	488	0.153	0.193	MDAR4_ARATH Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=MDAR4 PE=1 SV=1
15	Q3TY86	4.82e-22	102	605	0.171	0.174	AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus OX=10090 GN=Aifm3 PE=1 SV=1
16	Q9SR59	1.61e-21	100	441	0.162	0.224	MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana OX=3702 GN=MDAR3 PE=2 SV=1
17	P92947	2.27e-21	100	493	0.158	0.197	MDAR_ARATH Monodehydroascorbate reductase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MDAR5 PE=1 SV=3
18	P17052	8.76e-20	94.0	385	0.152	0.242	RURE_PSEOL Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans OX=301 GN=alkT PE=1 SV=1
19	X5CY81	9.27e-20	94.4	410	0.160	0.239	CNDC1_RHIWD Chloroacetanilide N-alkylformylase, ferredoxin reductase component OS=Rhizorhabdus wittichii (strain DC-6 / KACC 16600) OX=1283312 GN=cndC1 PE=1 SV=1
20	P77650	2.22e-19	92.8	400	0.121	0.185	HCAD_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) OX=83333 GN=hcaD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14962 AIF-MLS	1.9	19.9	Mitochondria Localisation Sequence
2	PF14721 AIF_C	1e-55	199.0	Apoptosis-inducing factor, mitochondrion-associated, C-term
3	PF01593 Amino_oxidase	2.6	18.9	Flavin containing amine oxidoreductase
4	PF12831 FAD_oxidored	3.9e+02	11.7	FAD dependent oxidoreductase
5	PF03486 HI0933_like	0.45	20.8	HI0933-like protein
6	PF06258 Mito_fiss_Elm1	4e+02	11.5	Mitochondrial fission ELM1
7	PF13450 NAD_binding_8	2.3e+02	13.5	NAD(P)-binding Rossmann-like domain
8	PF13454 NAD_binding_9	4.3	18.8	FAD-NAD(P)-binding
9	PF07831 PYNP_C	3.8e+02	12.1	Pyrimidine nucleoside phosphorylase C-terminal domain
10	PF00070 Pyr_redox	3.6e-12	57.9	Pyridine nucleotide-disulphide oxidoreductase
11	PF07992 Pyr_redox_2	4.4e-38	142.8	Pyridine nucleotide-disulphide oxidoreductase
12	PF13738 Pyr_redox_3	0.0014	29.6	Pyridine nucleotide-disulphide oxidoreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287295

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355759	0.965	Poly [ADP-ribose] polymerase 1
2	9606.ENSP00000361725	0.963	Endonuclease G, mitochondrial
3	9606.ENSP00000302564	0.951	Bcl-2-like protein 1
4	9606.ENSP00000419425	0.922	Peptidyl-prolyl cis-trans isomerase A
5	9606.ENSP00000381185	0.921	Apoptosis regulator Bcl-2
6	9606.ENSP00000293288	0.917	Apoptosis regulator BAX
7	9606.ENSP00000378040	0.914	Bcl2-associated agonist of cell death
8	9606.ENSP00000364802	0.848	Heat shock 70 kDa protein 1A
9	9606.ENSP00000384408	0.840	Poly(ADP-ribose) glycohydrolase
10	9606.ENSP00000318197	0.772	Tubulin alpha-3E chain
11	9606.ENSP00000362060	0.767	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
12	9606.ENSP00000311032	0.760	Caspase-3
13	9606.ENSP00000434024	0.746	Histone H2AX
14	9606.ENSP00000307786	0.736	Cytochrome c
15	9606.ENSP00000448165	0.732	Apoptotic protease-activating factor 1
16	9606.ENSP00000221130	0.727	Glutathione reductase, mitochondrial
17	9606.ENSP00000398495	0.722	Diablo homolog, mitochondrial
18	9606.ENSP00000287675	0.720	Nuclease EXOG, mitochondrial
19	9606.ENSP00000322439	0.710	Elongation factor Tu, mitochondrial
20	9606.ENSP00000360242	0.710	E3 ubiquitin-protein ligase XIAP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016491	1.000	oxidoreductase activity
GO:0005515	1.000	protein binding
GO:0050660	0.999	flavin adenine dinucleotide binding
GO:0050664	0.987	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
GO:0071949	0.896	FAD binding
GO:0003676	0.869	nucleic acid binding
GO:0003677	0.696	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0010941	0.962	regulation of cell death
GO:0048522	0.901	positive regulation of cellular process
GO:0043067	0.817	regulation of programmed cell death
GO:0042981	0.761	regulation of apoptotic process
GO:0008152	0.729	metabolic process
GO:0010942	0.703	positive regulation of cell death
GO:0019222	0.640	regulation of metabolic process
GO:0071840	0.636	cellular component organization or biogenesis
GO:0051171	0.604	regulation of nitrogen compound metabolic process
GO:0060255	0.602	regulation of macromolecule metabolic process
GO:0080090	0.599	regulation of primary metabolic process
GO:0012501	0.598	programmed cell death
GO:0016043	0.578	cellular component organization
GO:0043068	0.572	positive regulation of programmed cell death
GO:0043065	0.550	positive regulation of apoptotic process
GO:0007005	0.523	mitochondrion organization
GO:0006915	0.522	apoptotic process
GO:0050896	0.509	response to stimulus
GO:0051716	0.498	cellular response to stimulus
GO:0044237	0.474	cellular metabolic process
GO:0071704	0.472	organic substance metabolic process
GO:0051234	0.399	establishment of localization
GO:0006839	0.391	mitochondrial transport
GO:0033365	0.376	protein localization to organelle
GO:0072594	0.374	establishment of protein localization to organelle
GO:0006950	0.349	response to stress
GO:0009893	0.322	positive regulation of metabolic process
GO:0015031	0.313	protein transport
GO:0044238	0.312	primary metabolic process
GO:0007154	0.311	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0005634	0.997	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0016020	0.986	membrane
GO:0005829	0.982	cytosol
GO:0031090	0.980	organelle membrane
GO:0031966	0.961	mitochondrial membrane
GO:0032991	0.700	protein-containing complex
GO:0005654	0.507	nucleoplasm
GO:0005758	0.429	mitochondrial intermembrane space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	1.000	Oxidoreductases.
EC:1.6.3.-	0.987	With oxygen as acceptor.

[back to server]