StarFunc result for job id O95834

User Input

>input (649 residues)
MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWV
YGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTI
ATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVD
ESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLS
KRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGL
CALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSI
LQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDP
ARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSH
DNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQ
ITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLF
SYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQWRVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95834	1.000	1.000	0.000	649	1.000	1.000	O95834.pdb.gz	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
2	AFDB:O00423	0.991	0.790	5.251E-102	815	0.676	0.539	O00423.pdb.gz	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
3	AFDB:A0A0R4INC0	0.982	0.760	7.485E-99	840	0.644	0.498	A0A0R4INC0.pdb.gz
4	AFDB:B5MBZ0	0.957	0.629	3.022E-89	992	0.572	0.374	B5MBZ0.pdb.gz	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
5	AFDB:Q3UMY5	0.952	0.628	3.169E-89	988	0.572	0.376	Q3UMY5.pdb.gz	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
6	AFDB:Q32P44	0.952	0.693	2.876E-85	896	0.533	0.386	Q32P44.pdb.gz	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
7	AFDB:Q9VUI3	0.906	0.554	8.472E-63	1076	0.339	0.204	Q9VUI3.pdb.gz	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
8	AFDB:Q05BV3	0.876	0.293	1.647E-62	1969	0.353	0.116	Q05BV3.pdb.gz	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
9	AFDB:O45487	0.921	0.677	6.993E-59	891	0.291	0.212	O45487.pdb.gz	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
10	AFDB:A8ILK1	0.804	0.846	3.011E-36	615	0.186	0.197	A8ILK1.pdb.gz	CFA52_CHLRE Cilia- and flagella-associated protein 52 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP52 PE=1 SV=1
11	PDB:7rroe	0.745	0.789	4.336E-28	610	0.160	0.170	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:7mqaLQ	0.587	0.478	2.511E-27	830	0.160	0.125	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:1nr0A	0.650	0.686	9.485E-27	610	0.162	0.172	1nr0A.pdb.gz
14	PDB:7mqaLO	0.561	0.462	1.231E-25	819	0.143	0.114	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7ajtUA	0.561	0.455	4.032E-25	834	0.160	0.125	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:1pguB	0.580	0.612	1.675E-24	608	0.157	0.168	1pguB.pdb.gz	The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
17	PDB:7mq8LR	0.536	0.468	1.173E-23	773	0.157	0.132	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mq8LO	0.608	0.482	3.177E-23	848	0.149	0.114	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7ajuUL	0.531	0.455	5.355E-23	779	0.126	0.105	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7d5sB2	0.562	0.450	2.820E-22	851	0.143	0.109	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGQ7	0.0	860	427	0.647	0.984	A0A0C4DGQ7_HUMAN EMAP like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
2	A0A2R8RMY7	0.0	927	817	0.644	0.512	A0A2R8RMY7_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
3	B5MBZ0	0.0	814	992	0.569	0.372	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
4	E7EXY5	0.0	934	813	0.644	0.514	E7EXY5_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
5	O00423	0.0	977	815	0.676	0.539	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
6	O95834	0.0	1330	649	1.000	1.000	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
7	Q05BC3	0.0	969	814	0.673	0.537	EMAL1_MOUSE Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1
8	Q32P44	0.0	713	896	0.535	0.387	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
9	Q3UMY5	0.0	814	988	0.569	0.373	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
10	Q6P6T4	0.0	1267	649	0.940	0.940	EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1
11	Q9HC35	0.0	820	981	0.575	0.380	EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
12	Q9VUI3	4.28e-123	392	1076	0.348	0.210	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
13	Q05BV3	2.81e-115	382	1969	0.359	0.118	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
14	C4ALD8	1.09e-85	289	888	0.302	0.221	C4ALD8_CAEEL HELP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
15	O45487	1.36e-85	288	891	0.302	0.220	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
16	E9Q5M6	2.06e-18	92.4	1843	0.186	0.066	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
17	Q96KV7	9.13e-17	87.4	1748	0.173	0.064	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
18	A8J1V4	1.46e-14	80.1	1764	0.120	0.044	CFA44_CHLRE Cilia- and flagella-associated protein 44 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP44 PE=1 SV=1
19	A8IRK7	9.31e-14	77.0	815	0.197	0.157	CF251_CHLRE Cilia- and flagella-associated protein 251 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP251 PE=1 SV=1
20	Q96MT7	9.90e-14	77.4	1854	0.203	0.071	CFA44_HUMAN Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	2.8e-06	38.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF03178 CPSF_A	3.1e+02	12.1	CPSF A subunit region
3	PF16529 Ge1_WD40	1e+02	13.3	WD40 region of Ge1, enhancer of mRNA-decapping protein
4	PF03451 HELP	2.6e-27	105.8	HELP motif
5	PF20426 NBCH_WD40	6.4	17.1	Neurobeachin beta propeller domain
6	PF08801 Nucleoporin_N	1.9e+02	12.2	Nup133 N terminal like
7	PF00400 WD40	3.4e-23	92.7	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000011326

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000013523	0.688	NCK adaptor protein 2
2	9601.ENSPPYP00000002407	0.639	TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
3	9601.ENSPPYP00000022546	0.631	Uncharacterized protein DKFZp469M2415
4	9601.ENSPPYP00000002826	0.560	Uncharacterized protein
5	9601.ENSPPYP00000021955	0.534	NIMA-related kinase 6
6	9601.ENSPPYP00000006158	0.519	Protocadherin 9
7	9601.ENSPPYP00000006824	0.517	NIMA-related kinase 9
8	9601.ENSPPYP00000001402	0.513	Tubulin tyrosine ligase-like family, member 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008017	0.846	microtubule binding
GO:0043621	0.824	protein self-association

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.918	regulation of biological process
GO:0050794	0.901	regulation of cellular process
GO:0032501	0.821	multicellular organismal process
GO:0048519	0.775	negative regulation of biological process
GO:0009987	0.753	cellular process
GO:0048523	0.707	negative regulation of cellular process
GO:0051128	0.692	regulation of cellular component organization
GO:0010639	0.598	negative regulation of organelle organization
GO:0032886	0.596	regulation of microtubule-based process
GO:0044087	0.537	regulation of cellular component biogenesis
GO:0051493	0.530	regulation of cytoskeleton organization
GO:1902903	0.521	regulation of supramolecular fiber organization
GO:1902904	0.511	negative regulation of supramolecular fiber organization
GO:0070507	0.496	regulation of microtubule cytoskeleton organization
GO:0043254	0.420	regulation of protein-containing complex assembly
GO:0031110	0.391	regulation of microtubule polymerization or depolymerization
GO:0032271	0.388	regulation of protein polymerization
GO:0051494	0.377	negative regulation of cytoskeleton organization
GO:0031111	0.372	negative regulation of microtubule polymerization or depolymerization
GO:0007600	0.361	sensory perception
GO:0032272	0.353	negative regulation of protein polymerization
GO:0050953	0.349	sensory perception of light stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.996	cytoskeleton
GO:0015630	0.978	microtubule cytoskeleton
GO:0032991	0.952	protein-containing complex
GO:0005819	0.833	spindle
GO:0043227	0.794	membrane-bounded organelle
GO:0043231	0.766	intracellular membrane-bounded organelle
GO:0005829	0.722	cytosol
GO:0072686	0.608	mitotic spindle
GO:0005875	0.600	microtubule associated complex
GO:0005634	0.588	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]