StarFunc result for job id O95835

User Input

>input (1130 residues)
MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTE
DPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVI
QALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKG
SKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPP
QVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGY
PPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQTDFMIHQ
NVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNME
LYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQ
PSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNV
TVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENV
DSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHR
KKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVC
LARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYF
VMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDG
HIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAAR
QHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQM
KVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLR
QQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTF
RRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95835	1.000	1.000	0.000	1130	1.000	1.000	O95835.pdb.gz	LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1
2	AFDB:Q58FB8	0.405	0.428	2.320E-80	1068	0.629	0.666	Q58FB8.pdb.gz	Q58FB8_DANRE Large tumor suppressor OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
3	AFDB:A0A2R8QF71	0.425	0.422	7.628E-72	1140	0.488	0.484	A0A2R8QF71.pdb.gz
4	PDB:6byrA	0.249	0.680	1.305E-22	405	0.106	0.296	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
5	PDB:5x3fB	0.226	0.700	5.079E-20	349	0.103	0.332	5x3fB.pdb.gz
6	PDB:3c4wB	0.239	0.507	1.522E-19	519	0.083	0.181	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
7	PDB:4c0tA	0.233	0.852	2.968E-19	291	0.081	0.316	4c0tA.pdb.gz
8	PDB:3pvuA	0.235	0.427	7.006E-19	609	0.088	0.164	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
9	PDB:4mk0A	0.258	0.449	1.908E-18	631	0.095	0.170	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
10	PDB:6pjxA	0.262	0.519	1.908E-18	543	0.099	0.206	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
11	PDB:4yhjA	0.250	0.539	2.099E-18	501	0.095	0.214	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
12	PDB:3nynA	0.256	0.510	2.423E-18	554	0.093	0.190	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
13	PDB:3pfqA	0.230	0.490	2.423E-18	523	0.093	0.201	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
14	AFDB:Q9R1L5	0.253	0.184	6.107E-15	1570	0.164	0.118	Q9R1L5.pdb.gz	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
15	AFDB:Q9NYV4	0.210	0.162	6.328E-14	1490	0.165	0.126	Q9NYV4.pdb.gz	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
16	AFDB:Q8CEE6	0.205	0.169	2.842E-11	1383	0.157	0.128	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
17	AFDB:Q96RG2	0.207	0.178	1.031E-10	1323	0.145	0.124	Q96RG2.pdb.gz	PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK PE=1 SV=3
18	AFDB:P07527	0.190	0.241	2.945E-10	877	0.161	0.208	P07527.pdb.gz	WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wee1 PE=1 SV=1
19	AFDB:Q8INJ8	0.191	0.205	1.175E-9	1052	0.127	0.136	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
20	AFDB:Q3UVC0	0.211	0.245	2.404E-9	959	0.140	0.165	Q3UVC0.pdb.gz	KSR2_MOUSE Kinase suppressor of Ras 2 OS=Mus musculus OX=10090 GN=Ksr2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0S8I4	0.0	986	1140	0.519	0.515	B0S8I4_DANRE Large tumor suppressor kinase 2 OS=Danio rerio OX=7955 GN=si:ch211-173o4.2 PE=4 SV=1
2	B2BJC0	0.0	889	1078	0.401	0.420	B2BJC0_DANRE Lats2-2 OS=Danio rerio OX=7955 GN=si:ch211-173o4.2 PE=2 SV=1
3	B2BJC1	0.0	984	1140	0.519	0.514	B2BJC1_DANRE Lats2-1 OS=Danio rerio OX=7955 GN=si:ch211-173o4.2 PE=2 SV=1
4	O95835	0.0	2345	1130	1.000	1.000	LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1
5	Q58FB8	0.0	1285	1068	0.633	0.669	Q58FB8_DANRE Large tumor suppressor OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
6	Q5RIL6	0.0	1291	1068	0.635	0.672	Q5RIL6_DANRE LATS, large tumor suppressor, homolog 1 (Drosophila) OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
7	Q7TSJ6	0.0	898	1042	0.404	0.439	LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus OX=10090 GN=Lats2 PE=1 SV=1
8	Q8BYR2	0.0	2087	1129	0.931	0.932	LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus OX=10090 GN=Lats1 PE=1 SV=3
9	Q9VA38	0.0	666	1105	0.281	0.288	WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster OX=7227 GN=wts PE=1 SV=1
10	A9JTE1	3.69e-149	462	632	0.286	0.511	A9JTE1_DANRE Large tumor suppressor kinase 1 OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
11	O45797	2.10e-143	456	908	0.207	0.258	WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans OX=6239 GN=wts-1 PE=1 SV=1
12	Q9Y2H1	8.78e-125	392	464	0.163	0.397	ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens OX=9606 GN=STK38L PE=1 SV=3
13	A4GW50	3.06e-124	391	464	0.162	0.394	A4GW50_RAT Serine/threonine kinase 38 like OS=Rattus norvegicus OX=10116 GN=Stk38l PE=1 SV=1
14	Q7TSE6	4.81e-124	390	464	0.161	0.392	ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus OX=10090 GN=Stk38l PE=1 SV=2
15	Q54Y26	2.39e-122	388	530	0.174	0.372	NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum OX=44689 GN=ndrA PE=3 SV=1
16	A0A0U1RS40	6.18e-122	389	572	0.172	0.339	A0A0U1RS40_RAT Serine/threonine kinase 38 OS=Rattus norvegicus OX=10116 GN=Stk38 PE=1 SV=1
17	Q15208	6.37e-122	385	465	0.171	0.415	STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens OX=9606 GN=STK38 PE=1 SV=1
18	A0A8I5ZLY4	7.04e-122	385	473	0.172	0.410	A0A8I5ZLY4_RAT Serine/threonine kinase 38 OS=Rattus norvegicus OX=10116 GN=Stk38 PE=1 SV=1
19	G3V9Q4	2.79e-121	388	599	0.172	0.324	G3V9Q4_RAT Serine/threonine kinase 38 OS=Rattus norvegicus OX=10116 GN=Stk38 PE=1 SV=4
20	A0A0G2JT94	4.34e-121	382	436	0.158	0.411	A0A0G2JT94_RAT Serine/threonine kinase 38 like OS=Rattus norvegicus OX=10116 GN=Stk38l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.2	22.3	ABC1 atypical kinase-like domain
2	PF01636 APH	21	16.4	Phosphotransferase enzyme family
3	PF01881 Cas_Cas6_C	9.1	18.6	CRISPR associated protein Cas6, C-terminal
4	PF08463 EcoEI_R_C	38	15.9	EcoEI R protein C-terminal
5	PF12330 Haspin_kinase	52	14.2	Haspin like kinase domain
6	PF14531 Kinase-like	65	14.3	Kinase-like
7	PF00069 Pkinase	2.2e-58	209.3	Protein kinase domain
8	PF00433 Pkinase_C	63	15.7	Protein kinase C terminal domain
9	PF07714 PK_Tyr_Ser-Thr	8e-25	99.2	Protein tyrosine and serine/threonine kinase
10	PF00627 UBA	8.1e-07	40.1	UBA/TS-N domain
11	PF09288 UBA_3	2.7e+02	12.8	Fungal ubiquitin-associated domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437550

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324729	0.999	Protein salvador homolog 1
2	9606.ENSP00000379364	0.999	MOB kinase activator 1A
3	9606.ENSP00000379366	0.999	MOB kinase activator 1B
4	9606.ENSP00000478927	0.999	Transcriptional coactivator YAP1
5	9606.ENSP00000419465	0.998	WW domain-containing transcription regulator protein 1
6	9606.ENSP00000344666	0.997	Merlin
7	9606.ENSP00000429744	0.996	Serine/threonine-protein kinase 3
8	9606.ENSP00000361027	0.990	Angiomotin
9	9606.ENSP00000466953	0.990	Wilms tumor protein 1-interacting protein
10	9606.ENSP00000361892	0.988	Serine/threonine-protein kinase 4
11	9606.ENSP00000427772	0.988	Protein KIBRA
12	9606.ENSP00000273317	0.987	LIM domain-containing protein 1
13	9606.ENSP00000324422	0.985	Zyxin
14	9606.ENSP00000372035	0.949	Serine/threonine-protein kinase LATS2
15	9606.ENSP00000262713	0.945	LIM domain-containing protein ajuba
16	9606.ENSP00000435233	0.938	Transcriptional enhancer factor TEF-1
17	9606.ENSP00000480499	0.936	E3 ubiquitin-protein ligase Itchy homolog
18	9606.ENSP00000349547	0.905	Ras association domain-containing protein 1
19	9606.ENSP00000387739	0.896	Angiomotin-like protein 1
20	9606.ENSP00000352926	0.891	Transcriptional enhancer factor TEF-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0019899	0.995	enzyme binding
GO:0005524	0.992	ATP binding
GO:0000287	0.989	magnesium ion binding
GO:0140297	0.988	DNA-binding transcription factor binding
GO:0019900	0.988	kinase binding
GO:0019901	0.981	protein kinase binding
GO:0016922	0.975	nuclear receptor binding
GO:0030331	0.789	nuclear estrogen receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0007165	0.991	signal transduction
GO:0032501	0.971	multicellular organismal process
GO:0019222	0.965	regulation of metabolic process
GO:0035556	0.955	intracellular signal transduction
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0031323	0.951	regulation of cellular metabolic process
GO:0080090	0.948	regulation of primary metabolic process
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0048856	0.933	anatomical structure development
GO:0007275	0.924	multicellular organism development
GO:0048583	0.882	regulation of response to stimulus
GO:0048518	0.881	positive regulation of biological process
GO:0009653	0.863	anatomical structure morphogenesis
GO:0048522	0.859	positive regulation of cellular process
GO:0048519	0.842	negative regulation of biological process
GO:0048523	0.804	negative regulation of cellular process
GO:0010646	0.783	regulation of cell communication
GO:0023051	0.776	regulation of signaling
GO:0051246	0.771	regulation of protein metabolic process
GO:0065009	0.749	regulation of molecular function
GO:0071495	0.749	cellular response to endogenous stimulus
GO:0051174	0.725	regulation of phosphorus metabolic process
GO:0050790	0.720	regulation of catalytic activity
GO:0071704	0.702	organic substance metabolic process
GO:0044238	0.700	primary metabolic process
GO:0048646	0.697	anatomical structure formation involved in morphogenesis
GO:0009966	0.697	regulation of signal transduction
GO:0031399	0.694	regulation of protein modification process
GO:0009893	0.690	positive regulation of metabolic process
GO:0019220	0.687	regulation of phosphate metabolic process
GO:0010604	0.681	positive regulation of macromolecule metabolic process
GO:0044237	0.661	cellular metabolic process
GO:0051173	0.648	positive regulation of nitrogen compound metabolic process
GO:0031325	0.645	positive regulation of cellular metabolic process
GO:0009888	0.636	tissue development
GO:0006807	0.629	nitrogen compound metabolic process
GO:0051338	0.626	regulation of transferase activity
GO:0010605	0.625	negative regulation of macromolecule metabolic process
GO:0043170	0.623	macromolecule metabolic process
GO:0042325	0.617	regulation of phosphorylation
GO:0071840	0.588	cellular component organization or biogenesis
GO:0016043	0.567	cellular component organization
GO:0051172	0.553	negative regulation of nitrogen compound metabolic process
GO:0001932	0.523	regulation of protein phosphorylation
GO:0048513	0.510	animal organ development
GO:0019538	0.495	protein metabolic process
GO:0060429	0.494	epithelium development
GO:0031324	0.402	negative regulation of cellular metabolic process
GO:0009968	0.395	negative regulation of signal transduction
GO:0051247	0.388	positive regulation of protein metabolic process
GO:0036211	0.386	protein modification process
GO:0051128	0.356	regulation of cellular component organization
GO:0010468	0.349	regulation of gene expression
GO:0051179	0.328	localization
GO:0019219	0.309	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.301	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.999	cytosol
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005856	0.982	cytoskeleton
GO:0070013	0.968	intracellular organelle lumen
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0005654	0.945	nucleoplasm
GO:0015630	0.870	microtubule cytoskeleton
GO:0000922	0.632	spindle pole
GO:0016020	0.338	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]