StarFunc result for job id O95841

User Input

>input (491 residues)
MKTFTWTLGVLFFLLVDTGHCRGGQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRI
TGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLR
KESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYA
SLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQ
RDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPEN
SNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLS
NQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTT
LDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSL
RAVQMMIKPID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95841	1.000	1.000	1.271E-84	491	1.000	1.000	O95841.pdb.gz	ANGL1_HUMAN Angiopoietin-related protein 1 OS=Homo sapiens OX=9606 GN=ANGPTL1 PE=2 SV=1
2	AFDB:Q5KQU0	0.453	0.463	2.673E-58	480	0.633	0.648	Q5KQU0.pdb.gz	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
3	AFDB:Q9R045	0.441	0.440	1.238E-55	493	0.580	0.578	Q9R045.pdb.gz	ANGL2_MOUSE Angiopoietin-related protein 2 OS=Mus musculus OX=10090 GN=Angptl2 PE=2 SV=2
4	AFDB:B0UXH5	0.441	0.417	1.566E-54	519	0.576	0.545	B0UXH5.pdb.gz	B0UXH5_DANRE Angiopoietin-like 2b OS=Danio rerio OX=7955 GN=angptl2 PE=4 SV=1
5	AFDB:Q8NI99	0.450	0.470	1.025E-43	470	0.397	0.415	Q8NI99.pdb.gz	ANGL6_HUMAN Angiopoietin-related protein 6 OS=Homo sapiens OX=9606 GN=ANGPTL6 PE=1 SV=1
6	AFDB:Q8N539	0.441	0.469	5.962E-32	461	0.240	0.256	Q8N539.pdb.gz	FBCD1_HUMAN Fibrinogen C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FIBCD1 PE=1 SV=2
7	AFDB:Q1RLR4	0.427	0.604	2.458E-31	345	0.238	0.339	Q1RLR4.pdb.gz
8	AFDB:Q15485	0.426	0.664	1.013E-30	313	0.204	0.319	Q15485.pdb.gz	FCN2_HUMAN Ficolin-2 OS=Homo sapiens OX=9606 GN=FCN2 PE=1 SV=2
9	AFDB:O08538	0.424	0.419	1.624E-30	498	0.322	0.317	O08538.pdb.gz	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
10	AFDB:O43827	0.425	0.597	2.182E-30	346	0.236	0.335	O43827.pdb.gz	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
11	PDB:1jc9A	0.425	0.940	1.058E-29	220	0.185	0.414	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
12	PDB:1m1jB	0.442	0.538	1.188E-27	402	0.246	0.301	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
13	PDB:3ghgB	0.437	0.534	1.505E-27	401	0.248	0.304	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
14	PDB:3ghgI	0.438	0.543	1.119E-26	394	0.251	0.312	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
15	PDB:1ei3C	0.421	0.519	1.053E-24	397	0.251	0.310	1ei3C.pdb.gz
16	PDB:4wmqA	0.236	0.367	3.570E-4	283	0.088	0.152	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
17	PDB:5zc0A	0.239	0.367	6.442E-4	281	0.094	0.164	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
18	PDB:7fdeP	0.108	0.230	3.780E-2	181	0.037	0.099	7fdeP.pdb.gz
19	PDB:7uneU	0.091	0.102	5.709E-1	427	0.031	0.035	7uneU.pdb.gz
20	PDB:6l08A	0.051	0.077	6.424E-1	285	0.035	0.060	6l08A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0UXH5	0.0	553	519	0.552	0.522	B0UXH5_DANRE Angiopoietin-like 2b OS=Danio rerio OX=7955 GN=angptl2 PE=4 SV=1
2	O95841	0.0	1031	491	1.000	1.000	ANGL1_HUMAN Angiopoietin-related protein 1 OS=Homo sapiens OX=9606 GN=ANGPTL1 PE=2 SV=1
3	Q5KQT9	0.0	553	510	0.552	0.531	Q5KQT9_DANRE Angiopoietin-like 2 OS=Danio rerio OX=7955 GN=Angptl2 PE=2 SV=1
4	Q5KQU0	0.0	637	480	0.633	0.648	Q5KQU0_DANRE Angiopoietin-like 1 OS=Danio rerio OX=7955 GN=Angptl1 PE=2 SV=1
5	Q5RH53	0.0	637	480	0.633	0.648	Q5RH53_DANRE Angiopoietin-like 1a OS=Danio rerio OX=7955 GN=angptl1 PE=4 SV=1
6	Q640P2	0.0	963	490	0.929	0.931	ANGL1_MOUSE Angiopoietin-related protein 1 OS=Mus musculus OX=10090 GN=Angptl1 PE=2 SV=1
7	Q9R045	0.0	561	493	0.582	0.580	ANGL2_MOUSE Angiopoietin-related protein 2 OS=Mus musculus OX=10090 GN=Angptl2 PE=2 SV=2
8	Q9UKU9	0.0	554	493	0.558	0.556	ANGL2_HUMAN Angiopoietin-related protein 2 OS=Homo sapiens OX=9606 GN=ANGPTL2 PE=1 SV=1
9	Q8NI99	5.90e-121	364	470	0.403	0.421	ANGL6_HUMAN Angiopoietin-related protein 6 OS=Homo sapiens OX=9606 GN=ANGPTL6 PE=1 SV=1
10	Q8R0Z6	3.79e-111	338	457	0.365	0.392	ANGL6_MOUSE Angiopoietin-related protein 6 OS=Mus musculus OX=10090 GN=Angptl6 PE=2 SV=1
11	O15123	1.20e-63	216	496	0.312	0.308	ANGP2_HUMAN Angiopoietin-2 OS=Homo sapiens OX=9606 GN=ANGPT2 PE=1 SV=1
12	Q15389	7.29e-63	214	498	0.322	0.317	ANGP1_HUMAN Angiopoietin-1 OS=Homo sapiens OX=9606 GN=ANGPT1 PE=1 SV=2
13	O08538	1.74e-62	213	498	0.332	0.327	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
14	O35460	2.14e-62	213	497	0.326	0.322	ANGP1_RAT Angiopoietin-1 OS=Rattus norvegicus OX=10116 GN=Angpt1 PE=2 SV=2
15	Q8N539	2.60e-61	209	461	0.214	0.228	FBCD1_HUMAN Fibrinogen C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FIBCD1 PE=1 SV=2
16	Q9U8W7	3.96e-61	204	316	0.204	0.316	TL5B_TACTR Techylectin-5B OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
17	Q9Y264	5.46e-61	209	503	0.200	0.195	ANGP4_HUMAN Angiopoietin-4 OS=Homo sapiens OX=9606 GN=ANGPT4 PE=1 SV=1
18	O43827	4.01e-59	200	346	0.204	0.289	ANGL7_HUMAN Angiopoietin-related protein 7 OS=Homo sapiens OX=9606 GN=ANGPTL7 PE=1 SV=1
19	O35462	1.13e-57	200	496	0.305	0.302	ANGP2_RAT Angiopoietin-2 OS=Rattus norvegicus OX=10116 GN=Angpt2 PE=2 SV=2
20	O35608	1.59e-57	200	496	0.308	0.304	ANGP2_MOUSE Angiopoietin-2 OS=Mus musculus OX=10090 GN=Angpt2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00147 Fibrinogen_C	1.3e-69	245.9	Fibrinogen beta and gamma chains, C-terminal globular domain
2	PF04102 SlyX	4.3e+02	13.0	SlyX
3	PF16583 ZirS_C	3.3e+02	12.2	Zinc-regulated secreted antivirulence protein C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234816

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369375	0.820	Angiopoietin-1 receptor
2	9606.ENSP00000356607	0.755	Ras-specific guanine nucleotide-releasing factor RalGPS2
3	9606.ENSP00000479969	0.687	Angiopoietin-like protein 8
4	9606.ENSP00000263733	0.663	Glycosaminoglycan xylosylkinase
5	9606.ENSP00000361554	0.610	Tyrosine-protein kinase receptor Tie-1
6	9606.ENSP00000259351	0.535	Ras-specific guanine nucleotide-releasing factor RalGPS1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0007169	0.954	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0032502	0.515	developmental process
GO:0048856	0.480	anatomical structure development
GO:0032501	0.455	multicellular organismal process
GO:0008152	0.423	metabolic process
GO:0048583	0.383	regulation of response to stimulus
GO:0048518	0.376	positive regulation of biological process
GO:0048731	0.346	system development
GO:0048522	0.334	positive regulation of cellular process
GO:0071704	0.322	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0043226	0.980	organelle
GO:0043227	0.959	membrane-bounded organelle
GO:0031982	0.789	vesicle
GO:0065010	0.765	extracellular membrane-bounded organelle
GO:1903561	0.751	extracellular vesicle
GO:0005622	0.733	intracellular anatomical structure
GO:0070062	0.730	extracellular exosome
GO:0043229	0.708	intracellular organelle
GO:0071944	0.416	cell periphery
GO:0016020	0.335	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]