StarFunc result for job id O95847

User Input

>input (323 residues)
MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGD
GARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKS
EDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKI
LAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGL
VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRM
TPWSMVFWLTYEKIREMSGVSPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95847	1.000	1.000	2.598E-43	323	1.000	1.000	O95847.pdb.gz	UCP4_HUMAN Mitochondrial uncoupling protein 4 OS=Homo sapiens OX=9606 GN=SLC25A27 PE=1 SV=1
2	AFDB:Q9EPH5	0.922	0.820	3.072E-33	365	0.885	0.784	Q9EPH5.pdb.gz	Q9EPH5_RAT Solute carrier family 25, member 27, isoform CRA_d OS=Rattus norvegicus OX=10116 GN=Slc25a27 PE=2 SV=1
3	AFDB:Q9VX14	0.909	0.865	7.604E-27	340	0.548	0.521	Q9VX14.pdb.gz	Q9VX14_DROME RH64870p OS=Drosophila melanogaster OX=7227 GN=Ucp4A PE=1 SV=1
4	AFDB:O01883	0.872	0.869	1.015E-22	324	0.477	0.475	O01883.pdb.gz	O01883_CAEEL UnCoupling Protein (Mitochondrial substrate carrier) OS=Caenorhabditis elegans OX=6239 GN=ucp-4 PE=1 SV=2
5	AFDB:Q5SVS4	0.832	0.920	7.315E-19	291	0.353	0.392	Q5SVS4.pdb.gz	KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens OX=9606 GN=SLC25A30 PE=1 SV=1
6	AFDB:Q9SJY5	0.850	0.876	1.412E-18	313	0.322	0.332	Q9SJY5.pdb.gz	PUMP5_ARATH Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana OX=3702 GN=PUMP5 PE=2 SV=1
7	AFDB:O95258	0.825	0.820	2.131E-18	325	0.372	0.369	O95258.pdb.gz	UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens OX=9606 GN=SLC25A14 PE=1 SV=1
8	AFDB:Q9SB52	0.812	0.836	1.598E-17	313	0.313	0.323	Q9SB52.pdb.gz	PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana OX=3702 GN=PUMP4 PE=2 SV=1
9	AFDB:Q9VAJ9	0.812	0.827	5.719E-17	317	0.285	0.290	Q9VAJ9.pdb.gz	Q9VAJ9_DROME SD09259p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1907 PE=1 SV=1
10	AFDB:Q9ZWG1	0.818	0.864	6.470E-17	305	0.337	0.357	Q9ZWG1.pdb.gz	PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana OX=3702 GN=PUMP2 PE=2 SV=1
11	PDB:4c9qB	0.704	0.778	5.154E-10	290	0.204	0.228	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.694	0.759	4.948E-9	293	0.214	0.235	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:2lckA	0.459	0.485	1.845E-7	297	0.316	0.343	2lckA.pdb.gz
14	PDB:6gciA	0.480	0.517	5.836E-7	292	0.229	0.253	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
15	PDB:7p5cA	0.126	0.110	1.444E-1	392	0.133	0.110	7p5cA.pdb.gz
16	PDB:6rx4B	0.198	0.177	3.287E-1	379	0.105	0.090	6rx4B.pdb.gz	Homologous bd oxidases share the same architecture but differ in mechanism.
17	PDB:5mkkB	0.143	0.099	3.719E-1	577	0.118	0.066	5mkkB.pdb.gz
18	PDB:5oxpA	0.135	0.102	4.207E-1	462	0.142	0.100	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
19	PDB:3kdzA	0.175	0.124	4.568E-1	527	0.164	0.101	3kdzA.pdb.gz	Probing the active site of MIO-dependent aminomutases, key catalysts in the biosynthesis of beta-amino acids incorporated in secondary metabolites
20	PDB:7ru6A	0.167	0.169	4.760E-1	315	0.077	0.079	7ru6A.pdb.gz	Antiviral HIV-1 SERINC restriction factors disrupt virus membrane asymmetry.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ALR4	0.0	532	336	0.789	0.759	A0A8I6ALR4_RAT Solute carrier family 25, member 27 OS=Rattus norvegicus OX=10116 GN=Slc25a27 PE=3 SV=1
2	O95847	0.0	666	323	1.000	1.000	UCP4_HUMAN Mitochondrial uncoupling protein 4 OS=Homo sapiens OX=9606 GN=SLC25A27 PE=1 SV=1
3	Q6R5J6	0.0	551	275	0.811	0.953	Q6R5J6_RAT NYGGF5 OS=Rattus norvegicus OX=10116 GN=Slc25a27 PE=2 SV=1
4	Q9CX10	0.0	521	283	0.774	0.883	Q9CX10_MOUSE Mitochondrial uncoupling protein 4 OS=Mus musculus OX=10090 GN=Slc25a27 PE=2 SV=1
5	Q9D6D0	0.0	639	322	0.947	0.950	UCP4_MOUSE Mitochondrial uncoupling protein 4 OS=Mus musculus OX=10090 GN=Slc25a27 PE=2 SV=1
6	Q9EPH5	0.0	582	365	0.876	0.775	Q9EPH5_RAT Solute carrier family 25, member 27, isoform CRA_d OS=Rattus norvegicus OX=10116 GN=Slc25a27 PE=2 SV=1
7	Q9EPH6	0.0	585	344	0.870	0.817	Q9EPH6_RAT Solute carrier family 25, member 27, isoform CRA_c OS=Rattus norvegicus OX=10116 GN=Slc25a27 PE=2 SV=1
8	A0A8I5ZVX7	1.37e-165	465	311	0.715	0.743	A0A8I5ZVX7_RAT Solute carrier family 25, member 27 OS=Rattus norvegicus OX=10116 GN=Slc25a27 PE=3 SV=1
9	Q9VX14	1.37e-128	372	340	0.539	0.512	Q9VX14_DROME RH64870p OS=Drosophila melanogaster OX=7227 GN=Ucp4A PE=1 SV=1
10	O01883	1.62e-101	303	324	0.474	0.472	O01883_CAEEL UnCoupling Protein (Mitochondrial substrate carrier) OS=Caenorhabditis elegans OX=6239 GN=ucp-4 PE=1 SV=2
11	Q9CR58	1.66e-71	225	291	0.362	0.402	KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus OX=10090 GN=Slc25a30 PE=1 SV=1
12	Q5SVS4	2.01e-70	222	291	0.356	0.395	KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens OX=9606 GN=SLC25A30 PE=1 SV=1
13	O95258	4.51e-69	220	325	0.365	0.363	UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens OX=9606 GN=SLC25A14 PE=1 SV=1
14	O81845	1.18e-68	218	306	0.350	0.369	PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana OX=3702 GN=PUMP1 PE=1 SV=1
15	Q9Z2B2	4.03e-68	218	325	0.362	0.360	UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus OX=10090 GN=Slc25a14 PE=1 SV=2
16	Q9ZWG1	5.57e-66	211	305	0.344	0.364	PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana OX=3702 GN=PUMP2 PE=2 SV=1
17	P55916	1.30e-57	190	312	0.344	0.356	UCP3_HUMAN Putative mitochondrial transporter UCP3 OS=Homo sapiens OX=9606 GN=UCP3 PE=1 SV=1
18	Q7ZVP4	1.30e-57	190	309	0.316	0.330	Q7ZVP4_DANRE Mitochondrial brown fat uncoupling protein 1 OS=Danio rerio OX=7955 GN=ucp4 PE=2 SV=1
19	P56500	1.82e-57	189	309	0.319	0.333	UCP2_RAT Dicarboxylate carrier SLC25A8 OS=Rattus norvegicus OX=10116 GN=Ucp2 PE=2 SV=1
20	P55851	3.11e-57	189	309	0.316	0.330	UCP2_HUMAN Dicarboxylate carrier SLC25A8 OS=Homo sapiens OX=9606 GN=UCP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19996 ivWA-helical_N	3.8e+02	11.8	N-terminal helical region fused to the FtsH ternary system vWA domain
2	PF00153 Mito_carr	4.1e-62	217.4	Mitochondrial carrier protein
3	PF18405 SLC25_like	92	13.5	Mitochondrial SLC25 homolog

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301765	0.668	Vacuolar protein sorting-associated protein 37C
2	9606.ENSP00000216254	0.634	Aconitate hydratase, mitochondrial
3	9606.ENSP00000445725	0.593	E3 ubiquitin-protein ligase RNF170
4	9606.ENSP00000324960	0.577	Calcium-binding protein 4
5	9606.ENSP00000254250	0.567	THAP domain-containing protein 1
6	9606.ENSP00000407375	0.551	Glutathione peroxidase 1
7	9606.ENSP00000261721	0.538	BTB/POZ domain-containing protein 1
8	9606.ENSP00000225174	0.536	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
9	9606.ENSP00000349274	0.529	Protein phosphatase 1 regulatory subunit 26
10	9606.ENSP00000362392	0.528	Cilia- and flagella-associated protein 157
11	9606.ENSP00000314500	0.500	Polypeptide N-acetylgalactosaminyltransferase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008514	0.999	organic anion transmembrane transporter activity
GO:0046943	0.991	carboxylic acid transmembrane transporter activity
GO:0005488	0.813	binding
GO:0005515	0.624	protein binding
GO:1901702	0.424	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050789	0.996	regulation of biological process
GO:0048878	0.985	chemical homeostasis
GO:0010941	0.985	regulation of cell death
GO:0019725	0.983	cellular homeostasis
GO:0051049	0.983	regulation of transport
GO:0042981	0.981	regulation of apoptotic process
GO:0065008	0.980	regulation of biological quality
GO:0007423	0.980	sensory organ development
GO:0043069	0.976	negative regulation of programmed cell death
GO:0043066	0.974	negative regulation of apoptotic process
GO:0070997	0.970	neuron death
GO:0042127	0.970	regulation of cell population proliferation
GO:0070328	0.970	triglyceride homeostasis
GO:0046324	0.970	regulation of glucose import
GO:0051881	0.968	regulation of mitochondrial membrane potential
GO:0098771	0.967	inorganic ion homeostasis
GO:0055080	0.967	monoatomic cation homeostasis
GO:0051560	0.961	mitochondrial calcium ion homeostasis
GO:0048518	0.929	positive regulation of biological process
GO:0048522	0.903	positive regulation of cellular process
GO:0043583	0.863	ear development
GO:0008284	0.756	positive regulation of cell population proliferation
GO:0048839	0.730	inner ear development
GO:0008152	0.633	metabolic process
GO:0044237	0.483	cellular metabolic process
GO:0071704	0.372	organic substance metabolic process
GO:0051179	0.308	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.748	membrane
GO:0031090	0.361	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]